13 products were found matching "P79073"!

1 from 2 pages
No results were found for the filter!
Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar)
Hydrophobin-2/HFB2 Protein, Trichoderma reesei,...

Item number: TGM-TMPH-03644-10ug

Description: Responsible for spore hydrophobicity and protection. Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 23.2 kDa and the accession number is P79073.
Keywords: hfb2 , Hydrophobin II (HFBII) , Hydrophobin-2
MW: 23.2 kD
From 134.00€ *
Review
Hydrophobin-2 (hfb2), Hypocrea jecorina, recombinant
Hydrophobin-2 (hfb2), Hypocrea jecorina, recombinant

Item number: CSB-EP304437HYE.1

Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
Keywords: hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2)
Application: Activity not tested
Expressed in: E.coli
Origin: Hypocrea jecorina (Trichoderma reesei)
MW: 23.2 kD
From 364.00€ *
Review
Hydrophobin-2 (hfb2), Hypocrea jecorina, recombinant
Hydrophobin-2 (hfb2), Hypocrea jecorina, recombinant

Item number: CSB-EP304437HYEb0.1

Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
Keywords: hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2)
Application: Activity not tested
Expressed in: E.coli
Origin: Hypocrea jecorina (Trichoderma reesei)
MW: 10.7 kD
From 364.00€ *
Review
Hydrophobin-2 (hfb2), Hypocrea jecorina, recombinant
Hydrophobin-2 (hfb2), Hypocrea jecorina, recombinant

Item number: CSB-EP304437HYEb8.1

Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-B2M-JD-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 85% as...
Keywords: hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2)
Application: Activity not tested
Expressed in: E.coli
Origin: Hypocrea jecorina (Trichoderma reesei)
MW: 12.7 kD
From 364.00€ *
Review
Hydrophobin-2 (hfb2), Hypocrea jecorina, recombinant
Hydrophobin-2 (hfb2), Hypocrea jecorina, recombinant

Item number: CSB-YP304437HYE.1

Organism: Hypocrea jecorina (Trichoderma reesei). Source: Yeast. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 85% as...
Keywords: hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2)
Application: Activity not tested
Expressed in: Yeast
Origin: Hypocrea jecorina (Trichoderma reesei)
MW: 9.2 kD
From 407.00€ *
Review
Hydrophobin-2 (hfb2), Trichoderma reesei, recombinant
Hydrophobin-2 (hfb2), Trichoderma reesei, recombinant

Item number: CSB-YP304437HYEa4.1

Organism: Hypocrea jecorina (Trichoderma reesei). Source: Yeast. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-sumostar-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
Keywords: hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Trichoderma reesei Hydrophobin-2 (hfb2)
Application: Activity not tested
Expressed in: Yeast
Origin: Hypocrea jecorina (Trichoderma reesei)
MW: 23.2 kD
From 407.00€ *
Review
HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His & JD)
HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His...

Item number: TGM-TMPH-02338-100ug

Description: Responsible for spore hydrophobicity and protection. HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His & JD) is expressed in E. coli expression system with N-10xHis-B2M-JD tag. The predicted molecular weight is 12.7 kDa and the accession number is P79073.
Keywords: hfb2, Hydrophobin-2, Hydrophobin II
MW: 12.7 kD
From 340.00€ *
Review
Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar)
Hydrophobin-2/HFB2 Protein, Trichoderma reesei,...

Item number: TGM-TMPH-03644-100ug

Description: Responsible for spore hydrophobicity and protection. Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 23.2 kDa and the accession number is P79073.
Keywords: Hydrophobin II, hfb2, Hydrophobin-2
MW: 23.2 kD
From 375.00€ *
Review
HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His & JD)
HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His...

Item number: TGM-TMPH-02338-10ug

Description: Responsible for spore hydrophobicity and protection. HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His & JD) is expressed in E. coli expression system with N-10xHis-B2M-JD tag. The predicted molecular weight is 12.7 kDa and the accession number is P79073.
Keywords: Hydrophobin-2 , Hydrophobin II (HFBII) , hfb2
MW: 12.7 kD
From 122.00€ *
Review
Hydrophobin-2, Recombinant, Trichoderma Reesei, aa16-86, His-SUMOSTAR-tag (hfb2)
Hydrophobin-2, Recombinant, Trichoderma Reesei, aa16-86,...

Item number: 405951.100

Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from trichoderma reesei Hydrophobin-2, fused to His-SUMOSTAR-tag at N-terminal, expressed in yeast. Molecular Weight: ~23.2kD, AA Sequence:...
Keywords: hfb2, HFBII, Hydrophobin-2, Hydrophobin II
MW: 23,2
From 707.00€ *
Review
Hfb2, Recombinant, Hypocrea jecorina, aa16-86, His-SUMO-Tag (Hydrophobin-2)
Hfb2, Recombinant, Hypocrea jecorina, aa16-86,...

Item number: 373624.100

Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from hypocrea jecorina hfb2, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~23.2kD, AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF, Storage...
Keywords: hfb2, HFBII, Hydrophobin-2, Hydrophobin II
MW: 23,2
From 786.00€ *
Review
Hydrophobin-2, Recombinant, Hypocrea Jecorina, aa16-86, His-B2M-tag (hfb2)
Hydrophobin-2, Recombinant, Hypocrea Jecorina, aa16-86,...

Item number: 405950.20

Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from hypocrea jecorina Hydrophobin-2, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.7D, AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF,...
Keywords: hfb2, HFBII, Hydrophobin-2, Hydrophobin II
MW: 12,7
From 786.00€ *
Review
1 from 2 pages