- Search results for P79073
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "P79073"!
Close filters
Filter by:
No results were found for the filter!
Item number: TGM-TMPH-03644-10ug
Description: Responsible for spore hydrophobicity and protection. Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 23.2 kDa and the accession number is P79073.
| Keywords: | hfb2 , Hydrophobin II (HFBII) , Hydrophobin-2 |
| MW: | 23.2 kD |
From 134.00€
*
Item number: CSB-EP304437HYE.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
| Keywords: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 23.2 kD |
From 364.00€
*
Item number: CSB-EP304437HYEb0.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
| Keywords: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 10.7 kD |
From 364.00€
*
Item number: CSB-EP304437HYEb8.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-B2M-JD-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 85% as...
| Keywords: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 12.7 kD |
From 364.00€
*
Item number: CSB-YP304437HYE.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: Yeast. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 85% as...
| Keywords: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 9.2 kD |
From 407.00€
*
Item number: CSB-YP304437HYEa4.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: Yeast. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-sumostar-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
| Keywords: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Trichoderma reesei Hydrophobin-2 (hfb2) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 23.2 kD |
From 407.00€
*
Item number: TGM-TMPH-02338-100ug
Description: Responsible for spore hydrophobicity and protection. HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His & JD) is expressed in E. coli expression system with N-10xHis-B2M-JD tag. The predicted molecular weight is 12.7 kDa and the accession number is P79073.
| Keywords: | hfb2, Hydrophobin-2, Hydrophobin II |
| MW: | 12.7 kD |
From 340.00€
*
Item number: TGM-TMPH-03644-100ug
Description: Responsible for spore hydrophobicity and protection. Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 23.2 kDa and the accession number is P79073.
| Keywords: | Hydrophobin II, hfb2, Hydrophobin-2 |
| MW: | 23.2 kD |
From 375.00€
*
Item number: TGM-TMPH-02338-10ug
Description: Responsible for spore hydrophobicity and protection. HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His & JD) is expressed in E. coli expression system with N-10xHis-B2M-JD tag. The predicted molecular weight is 12.7 kDa and the accession number is P79073.
| Keywords: | Hydrophobin-2 , Hydrophobin II (HFBII) , hfb2 |
| MW: | 12.7 kD |
From 122.00€
*
Item number: 405951.100
Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from trichoderma reesei Hydrophobin-2, fused to His-SUMOSTAR-tag at N-terminal, expressed in yeast. Molecular Weight: ~23.2kD, AA Sequence:...
| Keywords: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II |
| MW: | 23,2 |
From 707.00€
*
Item number: 373624.100
Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from hypocrea jecorina hfb2, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~23.2kD, AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF, Storage...
| Keywords: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II |
| MW: | 23,2 |
From 786.00€
*
Item number: 405950.20
Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from hypocrea jecorina Hydrophobin-2, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.7D, AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF,...
| Keywords: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II |
| MW: | 12,7 |
From 786.00€
*