13 products were found matching "P57096"!

1 from 2 pages
No results were found for the filter!
Prostate stem cell antigen (Psca), mouse, recombinant
Prostate stem cell antigen (Psca), mouse, recombinant

Item number: CSB-YP018840MO.1

Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-95aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LQCYSCTAQM NNRDCLNVQN CSLDQHSCFT SRIRAIGLVT VISKGCSSQC EDDSENYYLG KKNITCCYSD LCNVN. Purity: Greater than 90% as determined by SDS-PAGE....
Keywords: Psca, Prostate stem cell antigen, Recombinant Mouse Prostate stem cell antigen (Psca)
Application: Activity not tested
Expressed in: Yeast
Origin: mouse
MW: 10.4 kD
From 292.00€ *
Review
Mouse PSCA Protein, hFc Tag
Mouse PSCA Protein, hFc Tag

Item number: DIM-PME-M100045.10

Recombinant mouse PSCA protein with C-terminal human Fc tag. Mouse PSCA(Leu21-Asn95) hFc(Glu99-Ala330), Protein function: May be involved in the regulation of cell proliferation. [The UniProt Consortium]
Keywords: UNQ206, PRO232
Expressed in: Human cells
Origin: mouse
MW: 34.5 kD
From 151.00€ *
Review
PSCA Protein, Mouse, Recombinant (hFc)
PSCA Protein, Mouse, Recombinant (hFc)

Item number: TGM-TMPK-00906-100ug

Description: Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers....
Keywords: PSCA, UNQ206, PRO232
MW: 34.5 kD
From 460.00€ *
Review
PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated
PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated

Item number: TGM-TMPY-06655-100ug

Description: PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 11.64 kDa and the accession number is P57096.
Keywords: 2210408B04Rik, prostate stem cell antigen
MW: 11.64 kD
From 568.00€ *
Review
PSCA Protein, Mouse, Recombinant (His)
PSCA Protein, Mouse, Recombinant (His)

Item number: TGM-TMPY-06710-100ug

Description: PSCA Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.83 kDa and the accession number is P57096.
Keywords: prostate stem cell antigen, 2210408B04Rik
MW: 9.83 kD
From 658.00€ *
Review
PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated
PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated

Item number: TGM-TMPY-06655-10ug

Description: PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 11.64 kDa and the accession number is P57096.
Keywords: prostate stem cell antigen , 2210408B04Rik
MW: 11.64 kD
From 202.00€ *
Review
PSCA Protein, Mouse, Recombinant (His)
PSCA Protein, Mouse, Recombinant (His)

Item number: TGM-TMPY-06710-10ug

Description: PSCA Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.8 kDa and the accession number is P57096.
Keywords: prostate stem cell antigen , 2210408B04Rik
MW: 9.8 kD
From 65.00€ *
Review
PSAP/Prosaposin, His, Mouse
PSAP/Prosaposin, His, Mouse

Item number: GSC-Z06323-100

Prosaposin (also known as SGP-1) is an intriguing multifunctional protein that plays roles both intracellularly, as a regulator of lysosomal enzyme function, and extracellularly, as a secreted factor with neuroprotective and glioprotective effects.
Keywords: Psca, Prostate stem cell antigen
Origin: mouse
MW: 60.86 kD
From 524.00€ *
Review
PSCA hFc Chimera, Mouse
PSCA hFc Chimera, Mouse

Item number: GSC-Z06325-100

Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers. Existing studies...
Keywords: Psca, Prostate stem cell antigen
Origin: mouse
MW: 34.5 kD
From 524.00€ *
Review
PSCA Protein, Mouse, Recombinant (hFc)
PSCA Protein, Mouse, Recombinant (hFc)

Item number: TGM-TMPK-00906-10ug

Description: Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers....
Keywords: UNQ206 , PSCA , PRO232
MW: 34.5 kD
From 55.00€ *
Review
PSCA, Recombinant, Mouse, aa21-95, His-Tag (Prostate Stem Cell Antigen)
PSCA, Recombinant, Mouse, aa21-95, His-Tag (Prostate Stem...

Item number: 374902.100

May be involved in the regulation of cell proliferation. Source: Recombinant protein corresponding to aa21-95 from mouse PSCA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.4kD, AA Sequence: LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN, Storage and...
Keywords: Psca, Prostate stem cell antigen
MW: 10,4
From 636.00€ *
Review
Mouse PSCA Protein
Mouse PSCA Protein

Item number: KT-PCA-MM101-100UG

Recombinant Mouse PSCA Protein is expressed from HEK293 with hFc tag at the N-Terminus.It contains Leu21-Asn95. Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol...
Keywords: PSCA, UNQ206, PRO232
Expressed in: Human cells
Origin: mouse
MW: 34.5 kD
From 353.00€ *
Review
1 from 2 pages