- Search results for P29400
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
14 products were found matching "P29400"!
Close filters
Filter by:
No results were found for the filter!
Item number: ELK-ELK5603.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human COL4a5. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human COL4a5....
Keywords: | COL4A5, Collagen alpha-5(IV) chain |
Application: | ELISA |
Species reactivity: | human |
From 365.00€
*
Item number: G-CAB9809.100
Application: | WB |
Host: | Rabbit |
Species reactivity: | human |
From 352.00€
*
Item number: ARG66926.100
Protein function: Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. [The UniProt Consortium]
Keywords: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, Anti-Collagen alpha-5(IV) chain |
Application: | IHC (paraffin) |
Host: | Rabbit |
Species reactivity: | human |
From 408.00€
*
Item number: ELK-ES4740.100
This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. Mutations in this gene are associated with X-linked Alport syndrome, also known as hereditary nephritis. Like the other members of the type IV collagen gene family, this gene is organized in a...
Keywords: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, COL4A5 rabbit pAb |
Application: | IHC, IF, WB, ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse |
From 169.00€
*
Item number: VHPS-2112
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | COL4A5, Collagen alpha-5(IV) chain |
Application: | RNA quantification |
43.00€
*
Item number: 034094-APC.200
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, FLISA, Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Keywords: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain |
Application: | FLISA, WB |
Host: | Rabbit |
Species reactivity: | human |
993.00€
*
Item number: 034094-Biotin.200
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Keywords: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human |
993.00€
*
Item number: 034094-FITC.200
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, FLISA, Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Keywords: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain |
Application: | FLISA, WB |
Host: | Rabbit |
Species reactivity: | human |
993.00€
*
Item number: 034094-HRP.200
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Keywords: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human |
993.00€
*
Item number: 034094.200
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Keywords: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human |
728.00€
*
Item number: 154093.10
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P29400, Fragment: Gly1461~Thr1685 (Accession No: P29400), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-GFLITRHSQT TDAPQCPQGT LQVYEGFSLL YVQGNKRAHG QDLGTAGSCL RRFSTMPFMF...
From 361.00€
*
Item number: 517108.96
This sandwich ELISA kit is used for in vitro quantitative measurement of COL4a5 in human serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Sensitivity: 1.12ng/ml, Range: 3.12-200ng/ml, Specificity: This assay has high sensitivity and excellent specificity for...
Keywords: | COL4A5, Collagen alpha-5(IV) chain |
Application: | ELISA |
Species reactivity: | human |
999.00€
*