- Search results for P26894
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
21 products were found matching "P26894"!
Close filters
Filter by:
No results were found for the filter!
Item number: DIY0728S-003
The swine IL-8 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-8 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...
| Keywords: | IL8, IL-8, CXCL8, Interleukin-8, C-X-C motif chemokine 8 |
| Application: | ELISA |
| Species reactivity: | swine |
From 1,098.00€
*
Item number: BR-A05421.96
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Keywords: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
802.00€
*
Item number: PB0143S-100
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Keywords: | Anti-IL-8, Anti-IL8, Anti-C-X-C motif chemokine 8, Anti-CXCL8 |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | swine, bovine, dog, feline, rabbit |
549.00€
*
Item number: G-PRFI00169.96
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Keywords: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
698.00€
*
NEW
Item number: G-AEES05437.480
Porcine IL-8 (Interleukin 8) Superset Max DIY ELISA Protein Function: Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection. Also plays an important role in neutrophil activation. Released in response to an...
| Keywords: | CXCL8, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage chemotactic factor I |
| Application: | ELISA |
| Species reactivity: | swine |
919.00€
*
NEW
Item number: G-AEKE05600.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL8. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL8. Next, Avidin...
| Keywords: | CXCL8, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage chemotactic factor I |
| Application: | ELISA |
| Species reactivity: | mouse |
694.00€
*
Item number: CR-C03006-100UG
Sequence: MARVSAELRC QCINTHSTPF HPKFIKELRV IESGPHCENS EIIVKLVNGK EVCLDPKEKW VQKVVQIFLK with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It...
| Keywords: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
From 618.00€
*
Item number: ELK-ELK1219.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL8. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL8. Next, Avidin...
| Keywords: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Application: | ELISA |
| Species reactivity: | swine |
From 432.00€
*
-10 %
Discount Promotion
Item number: E-EL-P3004.24
Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.83 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.
| Keywords: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Application: | ELISA |
| Species reactivity: | swine |
122.00€
*
From 109.80€
*
Item number: E-PKSS000006.5
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. Sequence: MTSKLAVAFLAVFLLSAALCEAAVLARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ. Fusion tag: N-His Endotoxin: Please contact us for more information....
| Keywords: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Application: | Active, cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
| MW: | 12.46 kD |
192.00€
*
Item number: CSB-E06787p.48
Sample Types: serum, plasma, cell culture supernates, tissue homogenates Detection Range: 125 pg/mL-8000 pg/mL Sensitivity: 31.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: IL-8 is a chemotactic factor that attracts...
| Keywords: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | swine |
From 420.00€
*
Item number: 517374.96
Specificity:, This assay has high sensitivity and excellent specificity for detection of Instant Interleukin 8 (IL8). No significant cross-reactivity or interference between Instant Interleukin 8 (IL8) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip...
| Keywords: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Application: | ELISA |
| Species reactivity: | swine |
1,104.00€
*