15 products were found matching "P26894"!

Sequence: MARVSAELRC QCINTHSTPF HPKFIKELRV IESGPHCENS EIIVKLVNGK EVCLDPKEKW VQKVVQIFLK with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It...

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL8. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL8. Next, Avidin...

The swine IL-8 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-8 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...

Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]

Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. (www.uniprot.org) Produced in E.coli as a single, non-glycosylated, polypeptide chain...

Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]

Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.83 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. Sequence: MTSKLAVAFLAVFLLSAALCEAAVLARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ. Fusion tag: N-His Endotoxin: Please contact us for more information....

Produced in Yeast. Amino acid sequence: ARVSAELRCQ CINTHSTPFH PKFIKELRVI ESGPHCENSE IIVKLVNGKE VCLDPKEKWV QKVVQIFLKR TEKQQQQQ (78). Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from...

Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]

Accession Number: P26894/