- Search results for P19707
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "P19707"!
Close filters
Filter by:
No results were found for the filter!
NEW
Item number: ELK-ELK11419.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Cat SAA. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Cat SAA. Next, Avidin...
| Keywords: | SAA1, Serum amyloid A protein |
| Application: | ELISA |
| Species reactivity: | cat |
From 481.00€
*
Item number: TGM-TMPH-00357-10ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.1 kDa and the accession number is P19707.
| Keywords: | Serum amyloid A protein , SAA1 , SAA |
| MW: | 12.1 kD |
From 134.00€
*
Item number: CSB-YP020656CA.1
Organism: Felis catus (Cat) (Felis silvestris catus). Source: Yeast. Expression Region: 1-90aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: EWYSFLGEAA QGAWDMWRAY SDMREANYIG ADKYFHARGN YDAAQRGPGG AWAAKVISDA RENSQRVTDF FRHGNSGHGA EDSKADQEWG. Purity: Greater than 90% as...
| Keywords: | SAA1, Recombinant Cat Serum amyloid A protein (SAA1), partial |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | cat |
| MW: | 12.1 kD |
From 407.00€
*
Item number: CSB-EP020656CA.1
Organism: Felis catus (Cat) (Felis silvestris catus). Source: E.coli. Expression Region: 1-90aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: EWYSFLGEAA QGAWDMWRAY SDMREANYIG ADKYFHARGN YDAAQRGPGG AWAAKVISDA RENSQRVTDF FRHGNSGHGA EDSKADQEWG. Purity: Greater than 90% as...
| Keywords: | SAA1, Recombinant Cat Serum amyloid A protein (SAA1), partial |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | cat |
| MW: | 24.1 kD |
From 364.00€
*
Item number: TGM-TMPH-00357-100ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.1 kDa and the accession number is P19707.
| Keywords: | Serum amyloid A protein, SAA1 |
| MW: | 12.1 kD |
From 375.00€
*
Item number: TGM-TMPH-00358-100ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707.
| Keywords: | SAA1, Serum amyloid A protein |
| MW: | 24.1 kD |
From 340.00€
*
Item number: TGM-TMPH-00358-10ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707.
| Keywords: | SAA1 , SAA , Serum amyloid A protein |
| MW: | 24.1 kD |
From 122.00€
*
Item number: 516100.100
Recombinant protein corresponding to aa1-111 from feline Amyloid A Serum (SAA), fused to a 10aa His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.8kD (Theoretical), Applications: Suitable for use in ELISA. May be used as a Control. Other applications not tested. Recommended Dilution: Optimal...
| Keywords: | SAA1 |
| Application: | ELISA, Control |
| Origin: | cat |
| MW: | 13.8 kD |
1,270.00€
*
Item number: 375188.100
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.1kD, AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG,...
| Keywords: | SAA1 |
| MW: | 12,1 |
From 707.00€
*
Item number: 370519.100
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD, AA Sequence:...
| Keywords: | SAA1 |
| MW: | 26,1 |
From 786.00€
*
Item number: CSB-PA020656ZA01CA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-SAA1, SAA1 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Felis catus (Cat) (Felis silvestris catus) |
From 1,529.00€
*