9 products were found matching "P17737"!
No results were found for the filter!
Antifungal protein (afp), Aspergillus giganteus, recombinant
Item number: CSB-EP325933APN.1
Organism: Aspergillus giganteus. Source: E.coli. Expression Region: 44-94aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: ATYNGKCYKK DNICKYKAQS GKTAICKCYV KKCPRDGAKC EFDSYKGKCY C. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not...
| Keywords: | afp, Antifungal protein, Recombinant Aspergillus giganteus Antifungal protein (afp) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | Aspergillus giganteus |
| MW: | 19.8 kD |
From 364.00€
*
Antifungal Protein, Aspergillus giganteus, Recombinant...
Item number: TGM-TMPH-00121-100ug
Description: This protein inhibits the growth of a variety of fungal species. Antifungal Protein, Aspergillus giganteus, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 19.8 kDa and the accession number is P17737.
| Keywords: | Antifungal protein, afp |
| MW: | 19.8 kD |
From 340.00€
*
Antifungal Protein, Aspergillus giganteus, Recombinant...
Item number: TGM-TMPH-00121-10ug
Description: This protein inhibits the growth of a variety of fungal species. Antifungal Protein, Aspergillus giganteus, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 19.8 kDa and the accession number is P17737.
| Keywords: | afp , Antifungal protein |
| MW: | 19.8 kD |
From 122.00€
*
Anti-afp
Item number: G-PACO53090.50
afp Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Aspergillus giganteus and for use in ELISA applications. afp Antibody is a high quality polyclonal antibody for research use only.. Protein function: This protein inhibits the growth of a variety of fungal species. [The UniProt...
| Keywords: | Anti-afp, Anti-Antifungal protein |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | Aspergillus giganteus |
313.00€
*
Antifungal Protein, Recombinant, Aspergillus Giganteus,...
Item number: 370524.100
This protein inhibits the growth of a variety of fungal species. Source: Recombinant protein corresponding to aa44-94 from Aspergillus giganteus Antifungal Protein, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.8kD, AA Sequence: ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC,...
| Keywords: | afp, Antifungal protein |
| Expressed in: | E.coli |
| Origin: | Aspergillus giganteus |
| MW: | 19.8 kD |
From 786.00€
*
Anti-afp, HRP conjugated
Item number: CSB-PA325933LB01APN.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: afp. Antigen Species: Aspergillus giganteus
| Keywords: | Anti-afp, Anti-Antifungal protein, afpAntifungal protein antibody, afp Antibody, HRP conjugated |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | Aspergillus giganteus |
From 167.00€
*
Anti-afp
Item number: CSB-PA325933LA01APN.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: afp. Antigen Species: Aspergillus giganteus
| Keywords: | Anti-afp, Anti-Antifungal protein, afpAntifungal protein antibody, afp Antibody |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | Aspergillus giganteus |
From 167.00€
*
Anti-afp, FITC conjugated
Item number: CSB-PA325933LC01APN.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: afp. Antigen Species: Aspergillus giganteus
| Keywords: | Anti-afp, Anti-Antifungal protein, afpAntifungal protein antibody, afp Antibody, FITC conjugated |
| Host: | Rabbit |
| Species reactivity: | Aspergillus giganteus |
From 167.00€
*
Anti-afp, Biotin conjugated
Item number: CSB-PA325933LD01APN.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: afp. Antigen Species: Aspergillus giganteus
| Keywords: | Anti-afp, Anti-Antifungal protein, afpAntifungal protein antibody, afp Antibody, Biotin conjugated |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | Aspergillus giganteus |
From 167.00€
*