- Search results for P12980
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
9 products were found matching "P12980"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA075004.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 82% and to rat: 82%
| Keywords: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Application: | ICC, ChIP |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: CSB-PA284084.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
284.00€
*
Item number: ATA-HPA072177.100
Polyclonal Antibody against Human LYL1, Gene description: LYL1 basic helix-loop-helix family member, Alternative Gene Names: bHLHa18, Validated applications: ICC, Uniprot ID: P12980, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 91% Rat gene identity: 91%
| Keywords: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Lymphoblastic leukemia-derived sequence 1, Anti-Class A... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: VHPS-5435
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | LYL1, bHLHa18, BHLHA18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1 |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST93260.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | LYL1, BHLHA18, bHLHa18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABD-8C10354.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-Lyl-1 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Keywords: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Application: | IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
628.00€
*
Item number: ELK-ES6144.100
This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by...
| Keywords: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Lymphoblastic leukemia-derived sequence 1, Anti-Class A... |
| Application: | IHC, IF, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
Item number: CSB-PA009891.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
126.00€
*
Item number: ATA-APrEST95852.100
PrEST Antigen LYL1, Gene description: LYL1 basic helix-loop-helix family member, Alternative Gene Names: bHLHa18, Antigen sequence: TAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 91% Rat gene identity: 91%
| Keywords: | LYL1, bHLHa18, BHLHA18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*