15 products were found matching "P10107"!
No results were found for the filter!
Annexin A1 (Anxa1), mouse, recombinant
Item number: CSB-EP001836MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 2-346aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: AMVSEFLKQA RFLENQEQEY VQAVKSYKGG PGSAVSPYPS FNVSSDVAAL HKAIMVKGVD EATIIDILTK RTNAQRQQIK AAYLQENGKP LDEVLRKALT GHLEEVVLAM LKTPAQFDAD...
| Keywords: | p35, Anx1, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 42.6 kD |
From 283.00€
*
Annexin A1 (Anxa1), mouse, recombinant
Item number: CSB-YP001836MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 2-346aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: AMVSEFLKQA RFLENQEQEY VQAVKSYKGG PGSAVSPYPS FNVSSDVAAL HKAIMVKGVD EATIIDILTK RTNAQRQQIK AAYLQENGKP LDEVLRKALT GHLEEVVLAM LKTPAQFDAD...
| Keywords: | p35, Anx1, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | mouse |
| MW: | 40.6 kD |
From 283.00€
*
Mouse ANXA1 Protein
Item number: KT-ANX-ME1A1-100UG
Recombinant Mouse ANXA1 Protein is expressed from E.coli with His tag at the C-Terminus.It contains Met1-Asn346. Atherosclerosis, characterized by the formation of fat-laden plaques, is a chronic inflammatory disease. ABCA1 promotes cholesterol efflux, reduces cellular cholesterol accumulation, and regulates...
| Keywords: | Annexin I, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, p35, ANX1, LPC1, Annexin A1, Annexin-1, ANXA1 |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 39.6 kD |
From 238.00€
*
Mouse ANXA1 (Annexin A1) ELISA Kit
Item number: ELK-ELK6293.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse ANXA1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse ANXA1. Next,...
| Keywords: | Anx1, Anxa1 |
| Application: | ELISA |
| Species reactivity: | mouse |
From 365.00€
*
Anti-Anxa1
Item number: G-PACO24916.50
Anxa1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse, Human and for use in ELISA, WB applications. Anxa1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Plays important roles in the innate immune response as effector of...
| Keywords: | Anti-p35, Anti-Anx1, Anti-Anxa1, Anti-Annexin I, Anti-Annexin-1, Anti-Annexin A1, Anti-Calpactin-2, Anti-Calpactin II,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | mouse, human |
363.00€
*
Anti-Anxa1
Item number: G-PACO24920.50
Anxa1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB, IP applications. Anxa1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Plays important roles in the innate immune response as effector of...
| Keywords: | Anti-p35, Anti-Anx1, Anti-Anxa1, Anti-Annexin I, Anti-Annexin-1, Anti-Annexin A1, Anti-Calpactin-2, Anti-Calpactin II,... |
| Application: | ELISA, WB, IP |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
363.00€
*
NEW
Mouse Annexin A1 (ANXA1) ELISA kit
Item number: CSB-EL001836MO.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 1.37ng/ml - 1000ng/ml Sensitivity: 1.37 ng/ml Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Plays important roles in the innate immune response as effector of...
| Keywords: | p35, Anx1, Anxa1, Annexin I, Annexin-1, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase... |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | mouse |
From 603.00€
*
NEW
ANXA1 Protein, Mouse, Recombinant (His)
Item number: TGM-TMPK-00799-100ug
Description: Atherosclerosis, characterized by the formation of fat-laden plaques, is a chronic inflammatory disease. ABCA1 promotes cholesterol efflux, reduces cellular cholesterol accumulation, and regulates anti-inflammatory activities in an apoA-I- or ANXA1-dependent manner. The latter activity occurs by...
| Keywords: | Lipocortin I, Annexin A1, ANX1, Calpactin II, Chromobindin-9, p35, Calpactin-2, Annexin I, ANXA1, Annexin-1, LPC1 |
| MW: | 39.6 kD |
From 363.00€
*
Anxa1, Mouse annexin A1, Real Time PCR Primer Set
Item number: VMPS-327
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | p35, Anx1, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase... |
| Application: | RNA quantification |
43.00€
*
Annexin A1 (ANXA1) BioAssay(TM) ELISA Kit (Mouse)
Item number: 023429.96
Annexin A1 (ANXA1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for the in vitro quantitative measurement of ANXA1 in mouse serum, plasma and other biological fluids. Detection Range: 1.56-100ng/ml, Sensitivity: 0.51ng/ml, Kit Components: 1. Microtiter Plate, 1x96 wells, 2. Standard,...
| Keywords: | p35, Anx1, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase... |
| Application: | ELISA |
| Species reactivity: | mouse |
1,016.00€
*
Annexin A1 (ANXA1) Recombinant, Mouse
Item number: 153516.10
Recombinant protein corresponding to aa6-346 with two N-terminal Tags, His-Tag and S-Tag from mouse ANXA1, expressed in E. coli (P10107), Amino Acid Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-EFLKQ ARFLENQEQE YVQAVKSYKG GPGSAVSPYP SFNVSSDVAA LHKAIMVKGV DEATIIDILT KRTNAQRQQI KAAYLQENGK PLDEVLRKAL...
From 399.00€
*
Mouse ANXA1 (Annexin A1) ELISA Kit (MOFI01462)
Item number: G-MOFI01462.96
ELISA Type: Sandwich. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma. Protein function: Plays important roles in the innate immune response as effector of glucocorticoid-mediated responses and regulator of the inflammatory process. Has anti-inflammatory activity...
| Keywords: | Anx1, Anxa1 |
| Application: | Sandwich ELISA |
| Species reactivity: | mouse |
641.00€
*