4 products were found matching "P0A7Q1"!
No results were found for the filter!
50S ribosomal protein L35 (rpmI), partial, Escherichia...
Item number: CSB-RP088044Ba.1
Organism: Escherichia coli (strain K12). Source: E.coli. Expression Region: 7-64aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VRGAAKRFKK TGKGGFKHKH ANLRHILTKK ATKRKRHLRP KAMVSKGDLG LVIACLPY. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological...
| Keywords: | rpmI, b1717, Ribosomal protein A, 50S ribosomal protein L35, Large ribosomal subunit protein bL35, Recombinant Escherichia... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | E.coli |
| MW: | 33.5 kD |
From 364.00€
*
RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S...
Item number: 375128.100
Source:, Recombinant protein corresponding to aa7-64 from E. coli 50S Ribosomal Protein L35, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.5kD, AA Sequence: VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | rpmI, b1717, Ribosomal protein A, 50S ribosomal protein L35, Large ribosomal subunit protein bL35 |
| MW: | 33,5 |
From 786.00€
*
Anti-rpmI
Item number: CSB-PA088044XA01ENV.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-rpmI, Anti-b1717, Anti-Ribosomal protein A, Anti-50S ribosomal protein L35, Anti-Large ribosomal subunit protein... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Escherichia coli (strain K12) |
1,529.00€
*
Anti-rpmI
Item number: CSB-PA088044ZA01ENV.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-rpmI, Anti-b1717, Anti-Ribosomal protein A, Anti-50S ribosomal protein L35, Anti-Large ribosomal subunit protein... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Escherichia coli (strain K12) |
From 1,529.00€
*
