23 products were found matching "P04640"!

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteocalcin, also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP), is a noncollagenous protein found in bone and dentin. In humans, the osteocalcin is encoded by the BGLAP gene. Its receptor is GPRC6A. It is mapped to 1q22. Osteocalcin may...

Type: Sandwich. Detection Range: 0.16~10ng/mL. Sensitivity: 0.09ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat OC/BGP . Standards or samples...

Protein function: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. [The UniProt Consortium]

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...

Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 50-99aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: YLNNGLGAPA PYPDPLEPHR EVCELNPNCD ELADHIGFQD AYKRIYGTTV. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....

Description: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Osteocalcin Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.6 kDa and the accession number is P04640.

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa50-99 from rat Bglap, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD, AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV, Storage and...

Type: Sandwich-ELISA. Detection Range: 31.25-2000 pg/mL. Sensitivity: 45.49 pg/mL. Tested Sample Types: Serum, plasma and other biological fluids. Test principle: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to OC/BGP ....

Sample Types: serum, plasma, tissue homogenates. Detection Range: 125 pg/mL- 8000 pg/mL Sensitivity: 31.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Constitutes 1-2% of the total bone protein. It binds strongly to...

Accession Number: P04640/