- Search results for P04640
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
23 products were found matching "P04640"!
Close filters
Filter by:
No results were found for the filter!
Item number: NSJ-R32433
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteocalcin, also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP), is a noncollagenous protein found in bone and dentin. In humans, the osteocalcin is encoded by the BGLAP gene. Its receptor is GPRC6A. It is mapped to 1q22. Osteocalcin may...
| Keywords: | Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing... |
| Application: | IHC (paraffin), FC |
| Host: | Rabbit |
| Species reactivity: | rat |
790.00€
*
Item number: E-CL-R0169.96
Type: Sandwich. Detection Range: 0.16~10ng/mL. Sensitivity: 0.09ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat OC/BGP . Standards or samples...
| Keywords: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Application: | CLIA |
| Species reactivity: | rat |
553.00€
*
Item number: ARG59341.50
Protein function: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. [The UniProt Consortium]
| Keywords: | Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing... |
| Application: | FC, IHC (paraffin) |
| Host: | Rabbit |
| Species reactivity: | rat |
551.00€
*
Item number: ELK-ELK2391.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...
| Keywords: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Application: | ELISA |
| Species reactivity: | rat |
From 374.00€
*
Item number: CSB-EP002682RA.1
Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 50-99aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: YLNNGLGAPA PYPDPLEPHR EVCELNPNCD ELADHIGFQD AYKRIYGTTV. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
| Keywords: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, Recombinant Rat... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | rat |
| MW: | 32.6 kD |
From 292.00€
*
Item number: TGM-TMPH-03346-100ug
Description: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Osteocalcin Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.6 kDa and the accession number is P04640.
| Keywords: | Gamma-carboxyglutamic acid-containing protein, Bglap, Osteocalcin, Bone Gla protein |
| MW: | 32.6 kD |
From 266.00€
*
Item number: E-PDER100164.1
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
| Keywords: | Bglap, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, Recombinant Rat OC/BGP... |
| Expressed in: | E.coli |
| Origin: | rat |
From 192.00€
*
NEW
Item number: G-AEKE06645.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...
| Keywords: | Bglap, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Application: | ELISA |
| Species reactivity: | rat |
694.00€
*
Item number: 370728.100
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa50-99 from rat Bglap, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD, AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV, Storage and...
| Keywords: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| MW: | 33 |
From 690.00€
*
Item number: E-EL-R3070.24
Type: Sandwich-ELISA. Detection Range: 31.25-2000 pg/mL. Sensitivity: 45.49 pg/mL. Tested Sample Types: Serum, plasma and other biological fluids. Test principle: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to OC/BGP ....
| Keywords: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Application: | ELISA |
| Species reactivity: | rat |
From 122.00€
*
Item number: CSB-E05129r.48
Sample Types: serum, plasma, tissue homogenates. Detection Range: 125 pg/mL- 8000 pg/mL Sensitivity: 31.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Constitutes 1-2% of the total bone protein. It binds strongly to...
| Keywords: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | rat |
From 711.00€
*