12 products were found matching "P04089"!

Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2- deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]

Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]

PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.

Sample Types: serum, plasma, tissue homogenates Detection Range: 6.25 pg/mL-400 pg/mL Sensitivity: 1.56 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: PTH elevates calcium level by dissolving the salts in bone and...

Endotoxin level: < 10 EU/mg of the protein as determined by the LAL method. Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]

Greater than 95% specific peptide. Parathyroid hormone (pTH) is the most important endocrine regulator of Ca2+ and phosphorus concentration in the extracellular fluid. pTH is secreted from cells of the parathyroid glands and acts for the most part via the binding to specific G-protein coupled receptors on the...

Greater than 95% specific peptide. Parathyroid hormone (pTH) is the most important endocrine regulator of Ca2+ and phosphorus concentration in the extracellular fluid. pTH is secreted from cells of the parathyroid glands and acts for the most part via the binding to specific G-protein coupled receptors on the...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity). Source: Synthetic rat PTH , AA Sequence: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF, Storage and Stability:...

ELISA Type: Sandwich. Detection Range: 15.63-1000µg/mL. Sensitivity: 9.38µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and...

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...