9 products were found matching "P02693"!

Fatty acid binding protein-2 (FABP2) is one of nine known cytosolic FABPs ranging in size from 14-15 kDa containing 127-132 amino acids. Members of this protein family exhibit high affinity for small lipophilic ligands and were named according to the tissue from which they were initially isolated. Studies suggest...

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat IFABP/FABP2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat...

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat IFABP/FABP2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat...

Sample Types: serum, plasma, urine, tissue homogenates Detection Range: 1.25 ng/mL-80 ng/mL Sensitivity: 0.312 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: FABP are thought to play a role in the intracellular transport...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P02693, Fragment: Ala2~Glu132 (Accession No: P02693), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AFDGTWKVD RNENYEKFME KMGINVVKRK LGAHDNLKLT ITQEGNKFTV KESSNFRNID VVFELGVDFA YSLADGTELT...

ELISA Type: Sandwich. Detection Range: 0.16-10µg/mL. Sensitivity: 0.1µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich...

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...