2 products were found matching "P01721"!
No results were found for the filter!
Anti-IGLV6-57
Item number: ATA-HPA028862.100
Polyclonal Antibody against Human IGLV6-57, Gene description: immunoglobulin lambda variable 6-57, Validated applications: IHC, Uniprot ID: P01721, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: V region of the variable domain of immunoglobulin light...
| Keywords: | Anti-Ig lambda chain V-VI region AR, Anti-Ig lambda chain V-VI region WLT, Anti-Ig lambda chain V-VI region EB4, Anti-Ig... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
463.00€
*
IGLV6-57 PrEST Antigen
Item number: ATA-APrEST95900.100
PrEST Antigen IGLV6-57, Gene description: immunoglobulin lambda variable 6-57, Antigen sequence: HSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHTVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: V region of the variable domain...
| Keywords: | Ig lambda chain V-VI region AR, Ig lambda chain V-VI region EB4, Ig lambda chain V-VI region WLT, Ig lambda chain V-VI... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
