106 products were found matching "P01275"!

1 from 9 pages
No results were found for the filter!
GLP-1 (7-13) (human, mouse, rat, bovine) (trifluoroacetate salt)
GLP-1 (7-13) (human, mouse, rat, bovine)...

Item number: Cay41255-1

Glucagon-like peptide 1 (GLP-1) (7-13) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460, Cay-24755). It contains several amino acids involved in binding and activation of the GLP-1 receptor (GLP-1R).Formal Name:...
Keywords: Glucagon-like Peptide 1 (7-13), His-Ala-Glu-Gly-Thr-Phe-Thr-OH,...
Application: GLP-1 peptide fragment
MW: 761.8 D
From 74.00€ *
Review
GLP-1 (7-15) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)
GLP-1 (7-15) (human, mouse, rat, porcine, bovine, ovine)...

Item number: Cay41256-1

Glucagon-like peptide 1 (GLP-1) (7-15) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460). GLP-1 (7-15) is formed by cleavage of the peptide bond between Asp15 and Val16 in GLP-1 by neprilysin.Formal Name:...
Keywords: Glucagon-like Peptide 1 (7-15),...
Application: GLP-1 peptide fragment
MW: 964 D
From 36.00€ *
Review
GLP-1 (7-17) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)
GLP-1 (7-17) (human, mouse, rat, porcine, bovine, ovine)...

Item number: Cay41257-1

Glucagon-like peptide 1 (GLP-1) (7-17) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460).Formal Name: L-histidyl-L-alanyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-serine, trifluoroacetate salt. Synonyms: Glucagon-like Peptide 1 (7-17)....
Keywords: Glucagon-like Peptide 1 (7-17),...
Application: GLP-1 peptide fragment
MW: 1150.2 D
From 35.00€ *
Review
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)

Item number: Cay41332-10

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a derivative of the endogenous incretin hormone glucagon-like peptide 1 (GLP-1, Cay-24460).Formal Name:...
Keywords: (S)-N1-((S)-6-amino-1-(((S)-3-hydroxy-1-(((3S,7S)-8-(((S)-3-hydroxy-1-(((2S,3R)-3-hydroxy-1-oxo-1-(((S)-1-oxo-3-phenylprop...
Application: GLP-1 derivative
MW: 3692.1 D
From 171.00€ *
Review
GCG Protein, Human, Recombinant (His)
GCG Protein, Human, Recombinant (His)

Item number: TGM-TMPJ-00742-10ug

Description: Glucagon is a secreted protein and belongs to the glucagon family. Glucagon can be cleved into 8 chains, playing an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon can regulates blood glucose by decreasing glycolysis and increasing gluconeogenesis. In...
Keywords: OXY, Incretin Hormone, Oxyntomodulin, Glicentin-Related Polypeptide, Glucagon-Like Peptide 2, Glucagon, GCG, GLP-1, GLP-2,...
MW: 19 kD
From 181.00€ *
Review
Anti-GCG
Anti-GCG

Item number: CSB-PA002654.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)...
Application: ELISA, WB, IHC, IF
Host: Rabbit
Species reactivity: human, mouse, rat, monkey
From 126.00€ *
Review
Anti-GCG
Anti-GCG

Item number: CSB-PA132302.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
Keywords: GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 167.00€ *
Review
Anti-GCG
Anti-GCG

Item number: CSB-PA135172.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
Keywords: GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 167.00€ *
Review
Anti-GCG Monoclonal
Anti-GCG Monoclonal

Item number: CSB-MA935920.100

Host Species: Mouse. Isotype: IgG2b, Kappa. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from mouse ascites by affinity-chromatography using specific...
Keywords: Glicentin, Glicentin-related polypeptide, Oxyntomodulin, Glucagon-like peptide 1(GLP-1), Glucagon-like peptide 1(7-37),...
Application: ELISA, IHC
Host: Mouse
Species reactivity: human
From 167.00€ *
Review
Anti-GCG
Anti-GCG

Item number: CSB-PA160122.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
Keywords: GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 167.00€ *
Review
Anti-GCG
Anti-GCG

Item number: CSB-PA165659.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
Keywords: GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-GCG
Anti-GCG

Item number: CSB-PA254989.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
Keywords: GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 167.00€ *
Review
1 from 9 pages