- Search results for O94772
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
17 products were found matching "O94772"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO28062.50
LY6H Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LY6H Antibody is a high quality polyclonal antibody for research use only.. Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In...
| Keywords: | Anti-LY6H, Anti-Ly-6H, Anti-Lymphocyte antigen 6H |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: CSB-YP013249HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 26-115aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LWCQDCTLTT NSSHCTPKQC QPSDTVCASV RITDPSSSRK DHSVNKMCAS SCDFVKRHFF SDYLMGFINS GILKVDVDCC EKDLCNGAAG. Purity: Greater than 90% as...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H, Recombinant Human Lymphocyte antigen 6H (LY6H) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 11.9 kD |
From 347.00€
*
Item number: DIM-PME101251.10
Recombinant Human LY6H Protein with C-terminal human Fc tag. LY6H(Leu26-Gly115) hFc(Glu99-Ala330), Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular...
| Keywords: | NMLY6 |
| Expressed in: | Human cells |
| Origin: | human |
| CAS | 12 |
| MW: | 36.0 kD |
From 116.00€
*
Item number: TGM-TMPJ-00709-10ug
Description: Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is...
| Keywords: | Ly-6H, LY6H, Lymphocyte Antigen 6H |
| MW: | 18 kD |
From 172.00€
*
Item number: TGM-TMPJ-00709-100ug
Description: Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is...
| Keywords: | Ly-6H , LY6H , Lymphocyte Antigen 6H |
| MW: | 18 kD |
From 105.00€
*
Item number: 374099.100
Source:, Recombinant protein corresponding to aa26-115 from human Lymphocyte Antigen 6H, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.9kD, AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG, Storage and Stability: May be stored at 4°C...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| MW: | 11,9 |
From 692.00€
*
Item number: E-PKSH032715.10
Protein Construction: Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus. Sequence: Leu26-Gly115. Fusion tag: C-6His Endotoxin: < 1.0 EU per µg as determined by the LAL method. Apparent...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H, Recombinant Human Lymphocyte Antigen 6H/LY6H Protein(C-6His) |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 10.9 kD |
From 156.00€
*
Item number: VHPS-5431
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST95451.100
Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-HPA077218.100
Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to...
| Keywords: | Anti-LY6H, Anti-Ly-6H, Anti-Lymphocyte antigen 6H |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: G-RPES3803.10
Human LY6H Recombinant Protein (RPES3803) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Expressed in: | Human cells |
| Origin: | human |
248.00€
*
Item number: CSB-CL013249HU.10
Length: 423 Sequence: atgctgcctg cagccatgaa gggcctcggc ctggcgctgc tggccgtcct gctgtgctcg gcgcccgctc atggcctgtg gtgccaggac tgcaccctga ccaccaactc cagccattgc accccaaagc agtgccagcc gtccgacacc gtgtgtgcca gtgtccgaat caccgatccc agcagcagca ggaaggatca ctcggtgaac aagatgtgtg cctcctcctg cgacttcgtt aagcgacact ttttctcaga...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*