17 products were found matching "O94772"!
No results were found for the filter!
Anti-LY6H
Item number: G-PACO28062.50
LY6H Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LY6H Antibody is a high quality polyclonal antibody for research use only.. Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In...
| Keywords: | Anti-LY6H, Anti-Ly-6H, Anti-Lymphocyte antigen 6H |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Lymphocyte antigen 6H (LY6H), human, recombinant
Item number: CSB-YP013249HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 26-115aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LWCQDCTLTT NSSHCTPKQC QPSDTVCASV RITDPSSSRK DHSVNKMCAS SCDFVKRHFF SDYLMGFINS GILKVDVDCC EKDLCNGAAG. Purity: Greater than 90% as...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H, Recombinant Human Lymphocyte antigen 6H (LY6H) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 11.9 kD |
From 347.00€
*
Human LY6H Protein, hFc Tag
Item number: DIM-PME101251.10
Recombinant Human LY6H Protein with C-terminal human Fc tag. LY6H(Leu26-Gly115) hFc(Glu99-Ala330), Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular...
| Keywords: | NMLY6 |
| Expressed in: | Human cells |
| Origin: | human |
| CAS | 12 |
| MW: | 36.0 kD |
From 116.00€
*
LY6H Protein, Human, Recombinant (His)
Item number: TGM-TMPJ-00709-10ug
Description: Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is...
| Keywords: | Ly-6H, LY6H, Lymphocyte Antigen 6H |
| MW: | 18 kD |
From 172.00€
*
LY6H Protein, Human, Recombinant (His)
Item number: TGM-TMPJ-00709-100ug
Description: Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is...
| Keywords: | Ly-6H , LY6H , Lymphocyte Antigen 6H |
| MW: | 18 kD |
From 105.00€
*
LY6H, Recombinant, Human, aa26-115, His-Tag (Lymphocyte...
Item number: 374099.100
Source:, Recombinant protein corresponding to aa26-115 from human Lymphocyte Antigen 6H, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.9kD, AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG, Storage and Stability: May be stored at 4°C...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| MW: | 11,9 |
From 692.00€
*
Lymphocyte Antigen 6H/LY6H Protein(C-6His) (recombinant...
Item number: E-PKSH032715.10
Protein Construction: Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus. Sequence: Leu26-Gly115. Fusion tag: C-6His Endotoxin: < 1.0 EU per µg as determined by the LAL method. Apparent...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H, Recombinant Human Lymphocyte Antigen 6H/LY6H Protein(C-6His) |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 10.9 kD |
From 156.00€
*
Human LY6H, recombinant (C-6His)
Item number: NOV-CA64.10ug
Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus. Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H, Recombinant Human LY6H (C-6His) |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 10.9 kD |
From 150.00€
*
LY6H, Human lymphocyte antigen 6 complex, locus H, Real...
Item number: VHPS-5431
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Application: | RNA quantification |
45.00€
*
LY6H PrEST Antigen
Item number: ATA-APrEST95451.100
Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-LY6H
Item number: ATA-HPA077218.100
Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to...
| Keywords: | Anti-LY6H, Anti-Ly-6H, Anti-Lymphocyte antigen 6H |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Recombinant Human LY6H Protein (His Tag) (RPES3803)
Item number: G-RPES3803.10
Human LY6H Recombinant Protein (RPES3803) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May...
| Keywords: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Expressed in: | Human cells |
| Origin: | human |
248.00€
*