- Search results for O75711
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
17 products were found matching "O75711"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-HUFI03075.96
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
698.00€
*
Item number: G-PACO35186.50
SCRG1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. SCRG1 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-SCRG1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: ATA-HPA012882.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 86%
| Keywords: | Anti-SCRG1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: CSB-YP530448HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 90% as determined by...
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 10.9 kD |
From 242.00€
*
Item number: CSB-EP530448HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 90% as determined by...
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 24.9 kD |
From 219.00€
*
Item number: CSB-EP530448HUa0.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 85% as determined by...
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.9 kD |
From 219.00€
*
Item number: TGM-TMPH-02064-100ug
Description: SCRG1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
| Keywords: | Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, SCRG1 |
| MW: | 24.9 kD |
From 187.00€
*
Item number: TGM-TMPH-02064-10ug
Description: SCRG1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
| Keywords: | SCRG1 , Scrapie-responsive gene 1 protein (ScRG-1) , Scrapie-responsive protein 1 |
| MW: | 24.9 kD |
From 71.00€
*
Item number: VHPS-8168
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Application: | RNA quantification |
45.00€
*
Item number: 375225.1
Source:, Recombinant protein corresponding to aa21-98 from human SCRG1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~24.9kD, AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| MW: | 24,9 |
From 603.00€
*
Item number: 518100.1
Source:, Recombinant protein corresponding to aa21-98 of human Scrapie-Responsive Protein 1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.9kD, AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ, Storage and Stability: May be stored at 4°C for...
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.9 kD |
From 603.00€
*
Item number: ATA-APrEST72151.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*