The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat PIP. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat PIP. Next, Avidin...

Organism: Rattus norvegicus (Rat). Source: Yeast. Expression Region: 27-146aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: QDNETIPQPL LFQLNVPSTP DENQEVDMSL TLQTQYKECL VVKAYLISNT PVDGGFNYIQ TRCICNDHPT TLYWTFVVTQ TLTFRIMVDI VKDKGICPNN VAVVPISGNR...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Source:, Recombinant protein corresponding to aa27-146 from rat Prolactin-inducible Protein Homolog, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.7kD, AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN,...