- Search results for O60931
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "O60931"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA046947.100
Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
| Keywords: | Anti-CTNS, Anti-Cystinosin |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ATA-HPA074687.100
Polyclonal Antibody against Human CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Validated applications: ICC, Uniprot ID: O60931, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-CTNS, Anti-Cystinosin |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: VHPS-2317
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | CTNS, Cystinosin |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST91085.100
Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CTNS, Cystinosin |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES17182.100
This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript...
| Keywords: | Anti-Cystinosin, CTNS rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: CSB-CL006174HU.10
Length: 1203 Sequence: atgataagga attggctgac tatttttatc ctttttcccc tgaagctcgt agagaaatgt gagtcaagcg tcagcctcac tgttcctcct gtcgtaaagc tggagaacgg cagctcgacc aacgtcagcc tcaccctgcg gccaccatta aatgcaaccc tggtgatcac ttttgaaatc acatttcgtt ccaaaaatat tactatcctt gagctccccg atgaagttgt ggtgcctcct ggagtgacaa actcctcttt...
| Keywords: | CTNS, Cystinosin |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-PA006174GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: CTNS. Antigen Species: Human
| Keywords: | Anti-CTNS, Anti-Cystinosin, ctns antibody, CTNS LSB antibody, CTNS_HUMAN antibody, Cystinosin antibody, Cystinosin,... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Item number: ATA-APrEST96215.100
PrEST Antigen CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Antigen sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Cystine/H(+) symporter...
| Keywords: | CTNS, Cystinosin |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*