8 products were found matching "O60931"!

No results were found for the filter!
Anti-CTNS
Anti-CTNS

Item number: ATA-HPA046947.100

Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
Keywords: Anti-CTNS, Anti-Cystinosin
Application: ICC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
Anti-CTNS
Anti-CTNS

Item number: ATA-HPA074687.100

Polyclonal Antibody against Human CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Validated applications: ICC, Uniprot ID: O60931, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Keywords: Anti-CTNS, Anti-Cystinosin
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
CTNS, Human cystinosis, nephropathic, Real Time PCR Primer Set
CTNS, Human cystinosis, nephropathic, Real Time PCR...

Item number: VHPS-2317

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: CTNS, Cystinosin
Application: RNA quantification
45.00€ *
Review
CTNS PrEST Antigen
CTNS PrEST Antigen

Item number: ATA-APrEST91085.100

Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: CTNS, Cystinosin
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-CTNS
Anti-CTNS

Item number: ELK-ES17182.100

This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript...
Keywords: Anti-Cystinosin, CTNS rabbit pAb
Application: WB
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
CTNS (Vector pENTR223.1, Accession No. BC032850)
CTNS (Vector pENTR223.1, Accession No. BC032850)

Item number: CSB-CL006174HU.10

Length: 1203 Sequence: atgataagga attggctgac tatttttatc ctttttcccc tgaagctcgt agagaaatgt gagtcaagcg tcagcctcac tgttcctcct gtcgtaaagc tggagaacgg cagctcgacc aacgtcagcc tcaccctgcg gccaccatta aatgcaaccc tggtgatcac ttttgaaatc acatttcgtt ccaaaaatat tactatcctt gagctccccg atgaagttgt ggtgcctcct ggagtgacaa actcctcttt...
Keywords: CTNS, Cystinosin
Application: Molecular biology, clone
Species reactivity: human
176.00€ *
Review
Anti-CTNS
Anti-CTNS

Item number: CSB-PA006174GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: CTNS. Antigen Species: Human
Keywords: Anti-CTNS, Anti-Cystinosin, ctns antibody, CTNS LSB antibody, CTNS_HUMAN antibody, Cystinosin antibody, Cystinosin,...
Application: ELISA, WB, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
552.00€ *
Review
CTNS PrEST Antigen
CTNS PrEST Antigen

Item number: ATA-APrEST96215.100

PrEST Antigen CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Antigen sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Cystine/H(+) symporter...
Keywords: CTNS, Cystinosin
Expressed in: E.coli
Origin: human
264.00€ *
Review