8 products were found matching "O00110"!

No results were found for the filter!
Putative transcription factor ovo-like protein 3 (OVOL3), human, recombinant
Putative transcription factor ovo-like protein 3 (OVOL3),...

Item number: CSB-EP522313HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-214aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: MPRAFLVRSR RPQPPNWGHL PDQLRGDAYI PGGPLTVPGG KGQERRSVTI WLFSSDCSSL GGPPAQQSSS VRDPWTAQPT QGNLTSAPRG PGTLGCPLCP KAFPLQRMLT...
Keywords: OVOL3, Putative transcription factor ovo-like protein 3, Recombinant Human Putative transcription factor ovo-like protein...
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 31.3 kD
From 364.00€ *
Review
OVOL3 Protein, Human, Recombinant (His & Myc)
OVOL3 Protein, Human, Recombinant (His & Myc)

Item number: TGM-TMPH-01989-100ug

Description: OVOL3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
Keywords: OVOL3, Putative transcription factor ovo-like protein 3
MW: 31.3 kD
From 340.00€ *
Review
Anti-OVOL3
Anti-OVOL3

Item number: ATA-HPA047540.100

Polyclonal Antibody against Human OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Validated applications: ICC, Uniprot ID: O00110, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May act as a transcription regulator. [The...
Keywords: Anti-OVOL3, Anti-Putative transcription factor ovo-like protein 3
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-OVOL3
Anti-OVOL3

Item number: ATA-HPA047540.25

Polyclonal Antibody against Human OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Validated applications: ICC, Uniprot ID: O00110, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May act as a transcription regulator. [The...
Keywords: Anti-OVOL3, Anti-Putative transcription factor ovo-like protein 3
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
OVOL3 Protein, Human, Recombinant (His & Myc)
OVOL3 Protein, Human, Recombinant (His & Myc)

Item number: TGM-TMPH-01989-10ug

Description: OVOL3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
Keywords: OVOL3 , Putative transcription factor ovo-like protein 3
MW: 31.3 kD
From 122.00€ *
Review
OVOL3 (human), recombinant protein
OVOL3 (human), recombinant protein

Item number: ABS-PP-1902.100

Protein function: May act as a transcription regulator. [The UniProt Consortium]
Keywords: Putative transcription factor ovo-like protein 3, Recombinant Human OVOL3 Protein
Expressed in: E.coli
Origin: human
MW: 10.5 kD
From 90.00€ *
Review
OVOL3 PrEST Antigen
OVOL3 PrEST Antigen

Item number: ATA-APrEST96013.100

PrEST Antigen OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Antigen sequence: CSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May act as a transcription regulator. [The UniProt Consortium]...
Keywords: OVOL3, Putative transcription factor ovo-like protein 3
Expressed in: E.coli
Origin: human
264.00€ *
Review
OVOL3 (human), recombinant protein
OVOL3 (human), recombinant protein

Item number: ABS-PP-1902-L.100

Protein function: May act as a transcription regulator. [The UniProt Consortium]
Keywords: Putative transcription factor ovo-like protein 3, Recombinant Human OVOL3 Protein
Expressed in: E.coli
Origin: human
MW: 10.5 kD
From 115.00€ *
Review