- Search results for K24645
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "K24645"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO53566.50
PRDM13 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB applications. PRDM13 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
313.00€
*
Item number: ATA-HPA069705.100
Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA062648.100
Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA069705.25
Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ATA-HPA062648.25
Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: CSB-PA887981LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA887981LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 167.00€
*
Item number: CSB-PA887981LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA887981LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ABS-PP-10331.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | PR domain zinc finger protein 13, PR domain-containing protein 13, Recombinant Human PRDM13 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 90.00€
*
Item number: ATA-APrEST96061.100
PrEST Antigen PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Antigen sequence: PLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICWYCW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional...
| Keywords: | PFM10, PRDM13, EC=2.1.1.-, PR domain-containing protein 13, PR domain zinc finger protein 13 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-10331-L.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | PR domain zinc finger protein 13, PR domain-containing protein 13, Recombinant Human PRDM13 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 115.00€
*