7 products were found matching "K24488"!
No results were found for the filter!
Anti-FNDC8
Item number: ATA-HPA026521.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 52%
| Keywords: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-FNDC8
Item number: ATA-HPA059803.100
Polyclonal Antibody against Human FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Validated applications: ICC, Uniprot ID: Q8TC99, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
| Keywords: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
FNDC8 (human), recombinant protein
Item number: ABS-PP-9760-L.100
| Keywords: | Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 115.00€
*
Anti-FNDC8, ID (FNDC8, Fibronectin type III...
Item number: 035704.200
Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
| Keywords: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
FNDC8 PrEST Antigen
Item number: ATA-APrEST75528.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | FNDC8, Fibronectin type III domain-containing protein 8 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
FNDC8 (human), recombinant protein
Item number: ABS-PP-9760.100
| Keywords: | Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 90.00€
*
FNDC8 PrEST Antigen
Item number: ATA-APrEST96089.100
PrEST Antigen FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Antigen sequence: EVAKTQENELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEPRQKIVSIGPEEMRRLEDLEYLFPC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Keywords: | FNDC8, Fibronectin type III domain-containing protein 8 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*