10 products were found matching "K24134"!
No results were found for the filter!
Anti-ZUFSP
Item number: ATA-HPA044426.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Keywords: | Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 330.00€
*
Anti-ZUP1
Item number: ATA-HPA076940.100
Polyclonal Antibody against Human ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Validated applications: ICC, Uniprot ID: Q96AP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-ZUP1
Item number: ATA-HPA076940.25
Polyclonal Antibody against Human ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Validated applications: ICC, Uniprot ID: Q96AP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Anti-ZUFSP, NT (ZUFSP, C6orf113, Zinc finger with...
Item number: 044425.200
Applications:, Suitable for use in Western Blot and ELISA. Other applications have not been tested. , Recommended Dilution: Western Blot: 1:1000, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing....
| Keywords: | Anti-ZUFSP, Anti-C6orf113, Anti-Zinc finger with UFM1-specific peptidase domain protein |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | hamster, human, mouse |
865.00€
*
ZUFSP PrEST Antigen
Item number: ATA-APrEST70192.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Keywords: | DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-ZUFSP
Item number: ELK-ES12066.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Keywords: | Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
ZUFSP (Vector Vector will be determined during the...
Item number: CSB-CL853384HU.10
Length: 1737 Sequence: atgctttcct gtaatatttg tggtgaaaca gtaacctcag aaccagacat gaaagctcac ctaattgttc acatggaaag tgaaattata tgtccatttt gcaagttgtc aggtgtgaat tatgatgaaa tgtgttttca tatcgaaaca gctcattttg agcagaatac acttgaaaga aactttgaga ggataaatac agtacaatat ggaacttcag ataacaagaa agacaacacc ctacagtgtg gaatggaagt...
| Keywords: | DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
357.00€
*
ZUP1 (human), recombinant protein
Item number: ABS-PP-9546.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Keywords: | Zinc finger-containing ubiquitin peptidase 1, Lys-63-specific deubiquitinase ZUFSP, DUB, Zinc finger with UFM1-specific... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31 kD |
From 90.00€
*
ZUP1 PrEST Antigen
Item number: ATA-APrEST95798.100
PrEST Antigen ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Antigen sequence: TSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Keywords: | DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZUP1 (human), recombinant protein
Item number: ABS-PP-9546-L.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Keywords: | Zinc finger-containing ubiquitin peptidase 1, Lys-63-specific deubiquitinase ZUFSP, DUB, Zinc finger with UFM1-specific... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31 kD |
From 115.00€
*