24 products were found matching "K23880"!
No results were found for the filter!
Reticulophagy regulator 1 (Retreg1), recombinant rat
Item number: CSB-CF691821RA.100
Organism: Rattus norvegicus (Rat). Source: in vitro E.coli expression system. Expression Region: 1-480aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: MASPAPEEHA TQGCPATEEQ EPRPGVPGEE AGPEGAGPQV EEAAGRVAAA LTWLLGEPVL WLGWRADELL SWKRPLRSLL AFLGANLLFW FLALTPWRVY HLISVMILGR...
| Keywords: | Fam134b, Reticulophagy receptor 1, Reticulophagy regulator 1 |
| Application: | Activity not tested |
| Expressed in: | E.coli in vitro |
| Origin: | rat |
| MW: | 58.8 kD |
From 1,458.00€
*
Anti-RETREG2
Item number: ATA-HPA075910.100
Polyclonal Antibody against Human RETREG2, Gene description: reticulophagy regulator family member 2, Alternative Gene Names: C2orf17, FAM134A, MAG-2, MGC3035, Validated applications: IHC, Uniprot ID: Q8NC44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene...
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-FAM134A
Item number: A305-800A-T
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 178.00€
*
Anti-FAM134C
Item number: A304-684A
Protein function: Mediates NRF1-enhanced neurite outgrowth. [The UniProt Consortium]
| Keywords: | Anti-FAM134C, Anti-Protein FAM134C |
| Application: | WB, IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 178.00€
*
Anti-FAM134A
Item number: A305-801A
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | WB, IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 178.00€
*
Anti-RETREG1
Item number: E-AB-18973.120
The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in...
| Keywords: | Anti-FAM134B, Anti-Reticulophagy receptor 1, Anti-Reticulophagy regulator 1, RETREG1 Polyclonal Antibody |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 89.00€
*
Anti-RETREG1
Item number: E-AB-52883.120
The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in...
| Keywords: | Anti-FAM134B, Anti-Reticulophagy receptor 1, Anti-Reticulophagy regulator 1, RETREG1 Polyclonal Antibody |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 89.00€
*
Anti-FAM134B
Item number: G-PACO49302.50
FAM134B Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. FAM134B Antibody is a high quality polyclonal antibody for research use only.. Protein function: Endoplasmic reticulum-anchored autophagy receptor that mediates ER delivery into...
| Keywords: | Anti-FAM134B, Anti-Reticulophagy receptor 1, Anti-Reticulophagy regulator 1 |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
384.00€
*
Anti-FAM134A
Item number: ATA-HPA011170.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 80%
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 320.00€
*
Anti-FAM134C
Item number: ATA-HPA016492.100
Protein function: Mediates NRF1-enhanced neurite outgrowth. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 86% and to rat: 85%
| Keywords: | Anti-FAM134C, Anti-Reticulophagy regulator 3 |
| Application: | IHC, WB, ICC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
450.00€
*
Anti-FAM134B
Item number: ATA-HPA012077.100
Protein function: Endoplasmic reticulum-anchored autophagy receptor that mediates ER delivery into lysosomes through sequestration into autophagosomes (PubMed:26040720). Promotes membrane remodeling and ER scission via its membrane bending capacity and targets the fragments into autophagosomes via interaction with...
| Keywords: | Anti-FAM134B, Anti-Reticulophagy receptor 1, Anti-Reticulophagy regulator 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 320.00€
*
RETREG2 PrEST Antigen
Item number: ATA-APrEST95680.100
PrEST Antigen RETREG2, Gene description: reticulophagy regulator family member 2, Alternative Gene Names: C2orf17, FAM134A, MAG-2, MGC3035, Antigen sequence: LIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 94% Rat...
| Keywords: | C2orf17, Reticulophagy regulator 2 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*