- Search results for K22558
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "K22558"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO37474.50
COMMD2 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. COMMD2 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes...
| Keywords: | Anti-COMMD2, Anti-HSPC042, Anti-COMM domain-containing protein 2 |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: ATA-HPA044190.100
Protein function: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF- kappa-B (PubMed:15799966). [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity...
| Keywords: | Anti-COMMD2, Anti-HSPC042, Anti-COMM domain-containing protein 2 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 246.00€
*
Item number: ATA-HPA075248.100
Polyclonal Antibody against Human COMMD2, Gene description: COMM domain containing 2, Alternative Gene Names: HSPC042, Validated applications: ICC, Uniprot ID: Q86X83, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May modulate activity of cullin-RING E3...
| Keywords: | Anti-COMMD2, Anti-HSPC042, Anti-COMM domain-containing protein 2 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA075248.25
Polyclonal Antibody against Human COMMD2, Gene description: COMM domain containing 2, Alternative Gene Names: HSPC042, Validated applications: ICC, Uniprot ID: Q86X83, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May modulate activity of cullin-RING E3...
| Keywords: | Anti-COMMD2, Anti-HSPC042, Anti-COMM domain-containing protein 2 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ATA-APrEST83995.100
Protein function: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF- kappa-B (PubMed:15799966). [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | COMMD2, HSPC042, COMM domain-containing protein 2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: CSB-CL774827HU.10
Length: 600 Sequence: atgctgctgg aattgtccga ggagcataag gaacacctgg ccttcctgcc tcaagtggac agcgcggtgg tcgccgagtt tgggcggatt gctgtggaat tcctgagacg cggcgcaaac ccaaaaatct acgaaggcgc cgccagaaaa ctcaatgtga gtagtgacac tgtccagcat ggtgtggaag gattaacgta tctcctcact gagagctcaa agctcatgat ttctgaactg gatttccaag actctgtttt...
| Keywords: | COMMD2, HSPC042, COMM domain-containing protein 2 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-PA774827LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: COMMD2. Antigen Species: Human
| Keywords: | Anti-COMMD2, Anti-HSPC042, Anti-COMM domain-containing protein 2, COMMD2 antibody, HSPC042 antibody, My004COMM... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA774827LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: COMMD2. Antigen Species: Human
| Keywords: | Anti-COMMD2, Anti-HSPC042, Anti-COMM domain-containing protein 2, COMMD2 antibody, HSPC042 antibody, My004COMM... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA774827LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: COMMD2. Antigen Species: Human
| Keywords: | Anti-COMMD2, Anti-HSPC042, Anti-COMM domain-containing protein 2, COMMD2 antibody, HSPC042 antibody, My004COMM... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA774827LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: COMMD2. Antigen Species: Human
| Keywords: | Anti-COMMD2, Anti-HSPC042, Anti-COMM domain-containing protein 2, COMMD2 antibody, HSPC042 antibody, My004COMM... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ABS-PP-7930.100
Protein function: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF- kappa-B (PubMed:15799966). [The UniProt Consortium]
| Keywords: | COMM domain-containing protein 2, Recombinant Human COMMD2 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 90.00€
*
Item number: ATA-APrEST96201.100
PrEST Antigen COMMD2, Gene description: COMM domain containing 2, Alternative Gene Names: HSPC042, Antigen sequence: ELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May modulate activity...
| Keywords: | COMMD2, HSPC042, COMM domain-containing protein 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*