9 products were found matching "K19373"!

No results were found for the filter!
Anti-DNAJC28
Anti-DNAJC28

Item number: ATA-HPA018003.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 87%
Keywords: Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28
Application: IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-DNAJC28
Anti-DNAJC28

Item number: ATA-HPA030076.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 62%
Keywords: Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28
Application: IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-DNAJC28
Anti-DNAJC28

Item number: ATA-HPA077153.100

Polyclonal Antibody against Human DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Validated applications: ICC, Uniprot ID: Q9NX36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
Keywords: Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
DNAJC28 (human), recombinant protein
DNAJC28 (human), recombinant protein

Item number: ABS-PP-6754-L.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]
Keywords: DnaJ homolog subfamily C member 28, Recombinant Human DNAJC28 Protein
Expressed in: E.coli
Origin: human
MW: 18.5 kD
From 115.00€ *
Review
Anti-DNAJC28, CT (DNAJC28, C21orf55, C21orf78, DnaJ homolog subfamily C member 28)
Anti-DNAJC28, CT (DNAJC28, C21orf55, C21orf78, DnaJ...

Item number: 034719.200

DNAJC28 may have a role in protein folding or as a chaperone. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots...
Keywords: Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
DNAJC28 PrEST Antigen
DNAJC28 PrEST Antigen

Item number: ATA-APrEST73895.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: DNAJC28, C21orf55, DnaJ homolog subfamily C member 28
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
DNAJC28 PrEST Antigen
DNAJC28 PrEST Antigen

Item number: ATA-APrEST78840.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: DNAJC28, C21orf55, DnaJ homolog subfamily C member 28
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
DNAJC28 (human), recombinant protein
DNAJC28 (human), recombinant protein

Item number: ABS-PP-6754.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]
Keywords: DnaJ homolog subfamily C member 28, Recombinant Human DNAJC28 Protein
Expressed in: E.coli
Origin: human
MW: 18.5 kD
From 90.00€ *
Review
DNAJC28 PrEST Antigen
DNAJC28 PrEST Antigen

Item number: ATA-APrEST96141.100

PrEST Antigen DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Antigen sequence: VLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAI, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: DNAJC28, C21orf55, DnaJ homolog subfamily C member 28
Expressed in: E.coli
Origin: human
264.00€ *
Review