12 products were found matching "K18762"!
No results were found for the filter!
Anti-ZAR1L
Item number: ATA-HPA041319.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 35% and to rat: 30%
| Keywords: | Anti-ZAR1L, Anti-ZAR1-like protein |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-ZAR1
Item number: CSB-PA004554.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor, Oocyte-specific maternal effect... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
126.00€
*
Anti-ZAR1
Item number: CSB-PA186654.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor, Oocyte-specific maternal effect... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
Anti-ZAR1L
Item number: ATA-HPA039540.100
Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
| Keywords: | Anti-ZAR1L, Anti-ZAR1-like protein |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
ZAR1 (human), recombinant protein
Item number: ABS-PP-6546-L.100
Protein function: Essential for female fertility. May play a role in the oocyte-to-embryo transition. [The UniProt Consortium]
| Keywords: | Zygote arrest protein 1, Recombinant Human ZAR1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12 kD |
From 115.00€
*
ZAR1L (human), recombinant protein
Item number: ABS-PP-9500-L.100
| Keywords: | Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 115.00€
*
Anti-ZAR1, ID (ZAR1, Zygote arrest protein 1,...
Item number: 043986.200
The female gamete, the oocyte, serves the distinct purpose of transmitting the maternal genome and other maternal factors critical for postovulation events. Oocytes have diverse functions in ovarian folliculogenesis, fertilization, and embryogenesis. ZAR1 is an oocyte-specific gene that appears to function at the...
| Keywords: | Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
ZAR1L PrEST Antigen
Item number: ATA-APrEST81392.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ZAR1L, ZAR1-like protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-ZAR1
Item number: ELK-ES3723.100
This maternal effect gene is oocyte-specific and encodes a protein that is thought to function in the initiation of embryogenesis. A similar protein in mouse is required for female fertility. [provided by RefSeq, Jul 2013], Protein function: mRNA-binding protein that mediates formation of MARDO...
| Keywords: | Anti-Zygote arrest protein 1, ZAR1 rabbit pAb |
| Application: | WB, IHC, IF, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
ZAR1 (human), recombinant protein
Item number: ABS-PP-6546.100
Protein function: Essential for female fertility. May play a role in the oocyte-to-embryo transition. [The UniProt Consortium]
| Keywords: | Zygote arrest protein 1, Recombinant Human ZAR1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12 kD |
From 90.00€
*
ZAR1L (human), recombinant protein
Item number: ABS-PP-9500.100
| Keywords: | Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 90.00€
*
ZAR1L PrEST Antigen
Item number: ATA-APrEST95928.100
PrEST Antigen ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Antigen sequence: FVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKAILSQMNPSLSPRLCKPNTK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 44% Rat gene identity:...
| Keywords: | ZAR1L, ZAR1-like protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*