24 products were found matching "K17542"!

Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 53%

Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt Consortium]

Polyclonal Antibody against Human SCYL3, Gene description: SCY1 like pseudokinase 3, Alternative Gene Names: PACE-1, PACE1, Validated applications: ICC, WB, Uniprot ID: Q8IZE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in regulating...

Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...

Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...

Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...

Polyclonal Antibody against Human SCYL3, Gene description: SCY1 like pseudokinase 3, Alternative Gene Names: PACE-1, PACE1, Validated applications: ICC, WB, Uniprot ID: Q8IZE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in regulating...

Recombinant human SCYL3 (2-end) was expressed by baculovirus in Sf9 insect cells using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >85% by densitometry. Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt...

Scyl3 may play a role in regulating cell adhesion/migration complexes in migrating cells. Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:10-50, Storage and Stability: May be stored at 4°C for...

Applications:, Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence:...

Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...

Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SLTEESMPWKSSLPQKISLVQRGDDADQIEPPKVSSQERPLKVPSELGLGEEFTIQVKKKPVKDPEMDWFADMIPEIKPSAAFLILPELRTEMVPKKDDVSPVMQFSS, Storage and...