12 products were found matching "K17530"!

No results were found for the filter!
Anti-DCLK3
Anti-DCLK3

Item number: 600-401-AT2

Anti-DCLK3 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with DCLK3 from other sources has not been determined.
Keywords: Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,...
Application: ELISA, IFM, WB
Host: Rabbit
Species reactivity: human, mouse
848.00€ *
Review
Anti-DCLK3
Anti-DCLK3

Item number: ATA-HPA040685.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 62% and to rat: 63%
Keywords: Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,...
Application: IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-DCLK3
Anti-DCLK3

Item number: CSB-PA002088.50

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,...
Application: ELISA, WB, IHC
Host: Rabbit
Species reactivity: human
126.00€ *
Review
Anti-DCLK3
Anti-DCLK3

Item number: CSB-PA990698.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Keywords: Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
284.00€ *
Review
Anti-DCLK3
Anti-DCLK3

Item number: ABS-KC-3389.100

Keywords: Anti-Serine/threonine-protein kinase DCLK3, Anti-Doublecortin domain-containing protein 3C, Anti-Doublecortin-like and CAM...
Host: Mouse
Species reactivity: human, mouse
From 232.00€ *
Review
Anti-DCLK3
Anti-DCLK3

Item number: ATA-HPA053234.100

Polyclonal Antibody against Human DCLK3, Gene description: doublecortin like kinase 3, Alternative Gene Names: DCAMKL3, DCDC3C, KIAA1765, Validated applications: ICC, Uniprot ID: Q9C098, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 53% Rat gene...
Keywords: Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
DCLK3 (human), recombinant protein
DCLK3 (human), recombinant protein

Item number: ABS-PP-9278-L.100

Keywords: Serine/threonine-protein kinase DCLK3, Doublecortin domain-containing protein 3C, Doublecortin-like and CAM kinase-like 3,...
Expressed in: E.coli
Origin: human
MW: 16 kD
From 115.00€ *
Review
DCLK3 PrEST Antigen
DCLK3 PrEST Antigen

Item number: ATA-APrEST94096.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: DCLK3, DCAMKL3, EC=2.7.11.1, Doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3, Doublecortin-like and CAM...
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-DCLK3
Anti-DCLK3

Item number: ABD-8C11659.50

Custom conjugation services for this antibody as available (eg. labeling of Anti-DCLK3 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Keywords: Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,...
Application: IHC, ELISA
Host: Rabbit
Species reactivity: human
628.00€ *
Review
Anti-DCAMKL3
Anti-DCAMKL3

Item number: ELK-ES2151.100

catalytic activity:ATP + a protein = ADP + a phosphoprotein.,similarity:Belongs to the protein kinase superfamily.,similarity:Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.,similarity:Contains 1 protein kinase domain., Recommended dilutions: Western Blot: 1/500 -...
Keywords: Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,...
Application: WB, IHC, IF, ELISA
Host: Rabbit
Species reactivity: human, rat, mouse,
From 173.00€ *
Review
DCLK3 (human), recombinant protein
DCLK3 (human), recombinant protein

Item number: ABS-PP-9278.100

Keywords: Serine/threonine-protein kinase DCLK3, Doublecortin domain-containing protein 3C, Doublecortin-like and CAM kinase-like 3,...
Expressed in: E.coli
Origin: human
MW: 16 kD
From 90.00€ *
Review
DCLK3 PrEST Antigen
DCLK3 PrEST Antigen

Item number: ATA-APrEST95892.100

PrEST Antigen DCLK3, Gene description: doublecortin like kinase 3, Alternative Gene Names: DCAMKL3, DCDC3C, KIAA1765, Antigen sequence: PRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKL, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: DCLK3, DCAMKL3, EC=2.7.11.1, Doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3, Doublecortin-like and CAM...
Expressed in: E.coli
Origin: human
264.00€ *
Review