13 products were found matching "K17436"!
No results were found for the filter!
Anti-MRPL55
Item number: ATA-HPA027641.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 78%
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
39S ribosomal protein L55, mitochondrial (MRPL55), human,...
Item number: CSB-EP014872HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 34-128aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: DSSRASLTRV HRQAYARLYP VLLVKQDGST IHIRYREPRR MLAMPIDLDT LSPEERRARL RKREAQLQSR KEYEQELSDD LHVERYRQFW TRTKK. Purity: Greater than 90% as...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 38.6 kD |
From 219.00€
*
MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S...
Item number: 374273.1
Source:, Recombinant protein corresponding to aa34-128 from human MRPL55, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD, AA Sequence: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK, Storage and Stability: May be stored at 4°C for...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| MW: | 38,6 |
From 603.00€
*
MRPL55 PrEST Antigen
Item number: ATA-APrEST77022.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-MRPL55
Item number: G-CAB18242.20
MRPL55 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human and for use in WB applications.MRPL55 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
103.00€
*
Anti-Mrpl55
Item number: G-CAB18244.20
Mrpl55 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse and for use in WB applications.Mrpl55 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Keywords: | Anti-L55mt, Anti-Mrpl55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
103.00€
*
Anti-RM55
Item number: ELK-ES9307.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-Large ribosomal subunit protein mL55, Anti-39S ribosomal protein L55,... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
MRPL55 (Vector Vector will be determined during the...
Item number: CSB-CL768781HU.10
Length: 387 Sequence: atggcggccg tgggcagcct gcttggccgg ctgaggcaga gcaccgtgaa ggccaccgga cctgcactcc gccgcctgca cacatcctcc tggcgagctg acagcagcag ggcctcactc actcgtgtgc accgccaggc ttatgcacga ctctaccccg tgctgctggt gaagcaggat ggctccacca tccacatccg ctacagggag ccacggcgca tgctggcgat gcccatagat ctggacaccc tgtctcctga...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Anti-MRPL55
Item number: CSB-PA014872EA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MRPL55, FITC conjugated
Item number: CSB-PA014872EC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MRPL55, HRP conjugated
Item number: CSB-PA014872EB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MRPL55, Biotin conjugated
Item number: CSB-PA014872ED01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*