13 products were found matching "K17436"!
No results were found for the filter!
Anti-MRPL55
Item number: ATA-HPA027641.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 78%
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
39S ribosomal protein L55, mitochondrial (MRPL55), human,...
Item number: CSB-EP014872HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 34-128aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: DSSRASLTRV HRQAYARLYP VLLVKQDGST IHIRYREPRR MLAMPIDLDT LSPEERRARL RKREAQLQSR KEYEQELSDD LHVERYRQFW TRTKK. Purity: Greater than 90% as...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 38.6 kD |
From 219.00€
*
MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S...
Item number: 374273.1
Source:, Recombinant protein corresponding to aa34-128 from human MRPL55, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD, AA Sequence: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK, Storage and Stability: May be stored at 4°C for...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| MW: | 38,6 |
From 603.00€
*
MRPL55 PrEST Antigen
Item number: ATA-APrEST77022.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-MRPL55
Item number: G-CAB18242.100
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 103.00€
*
Anti-Mrpl55
Item number: G-CAB18244.100
| Keywords: | Anti-L55mt, Anti-Mrpl55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Mrpl55 Rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 103.00€
*
Anti-RM55
Item number: ELK-ES9307.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-Large ribosomal subunit protein mL55, Anti-39S ribosomal protein L55,... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
MRPL55 (Vector Vector will be determined during the...
Item number: CSB-CL768781HU.10
Length: 387 Sequence: atggcggccg tgggcagcct gcttggccgg ctgaggcaga gcaccgtgaa ggccaccgga cctgcactcc gccgcctgca cacatcctcc tggcgagctg acagcagcag ggcctcactc actcgtgtgc accgccaggc ttatgcacga ctctaccccg tgctgctggt gaagcaggat ggctccacca tccacatccg ctacagggag ccacggcgca tgctggcgat gcccatagat ctggacaccc tgtctcctga...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Anti-MRPL55
Item number: CSB-PA014872EA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MRPL55, FITC conjugated
Item number: CSB-PA014872EC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MRPL55, HRP conjugated
Item number: CSB-PA014872EB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MRPL55, Biotin conjugated
Item number: CSB-PA014872ED01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*