- Search results for K16767
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
10 products were found matching "K16767"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG55071.100
| Keywords: | Anti-CEP112, Anti-Cep112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
616.00€
*
Item number: ATA-HPA024481.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 82% and to rat: 77%
| Keywords: | Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA069724.100
Polyclonal Antibody against Human CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Validated applications: ICC, Uniprot ID: Q8N8E3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
| Keywords: | Anti-CCDC46, Anti-CEP112, Anti-Cep112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: ATA-HPA069724.25
Polyclonal Antibody against Human CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Validated applications: ICC, Uniprot ID: Q8N8E3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
| Keywords: | Anti-CCDC46, Anti-CEP112, Anti-Cep112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ABS-PP-8008-L.100
| Keywords: | Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 115.00€
*
Item number: 033326.200
CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of this gene exist in mouse, rat and chimp. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000,...
| Keywords: | Anti-CCDC46, Anti-CEP112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST75738.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | Cep112, CEP112, CCDC46, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES17530.100
This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate...
| Keywords: | Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: ABS-PP-8008.100
| Keywords: | Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 90.00€
*
Item number: ATA-APrEST96046.100
PrEST Antigen CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Antigen sequence: LMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 100% Rat gene identity: 100%
| Keywords: | CCDC46, Cep112, CEP112, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*