9 products were found matching "K16767"!

No results were found for the filter!
Anti-CEP112 / CCDC46
Anti-CEP112 / CCDC46

Item number: ARG55071.100

Keywords: Anti-CEP112, Anti-Cep112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Application: WB
Host: Rabbit
Species reactivity: human
616.00€ *
Review
Anti-CEP112
Anti-CEP112

Item number: ATA-HPA024481.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 82% and to rat: 77%
Keywords: Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Application: ICC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-CEP112
Anti-CEP112

Item number: ATA-HPA069724.100

Polyclonal Antibody against Human CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Validated applications: ICC, Uniprot ID: Q8N8E3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
Keywords: Anti-CCDC46, Anti-CEP112, Anti-Cep112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
CEP112 (human), recombinant protein
CEP112 (human), recombinant protein

Item number: ABS-PP-8008-L.100

Keywords: Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein
Expressed in: E.coli
Origin: human
MW: 15 kD
From 115.00€ *
Review
Anti-CCDC46, NT (CEP112, CCDC46, Centrosomal protein of 112kD, Coiled-coil domain-containing protein
Anti-CCDC46, NT (CEP112, CCDC46, Centrosomal protein of...

Item number: 033326.200

CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of this gene exist in mouse, rat and chimp. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000,...
Keywords: Anti-CCDC46, Anti-CEP112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
CEP112 PrEST Antigen
CEP112 PrEST Antigen

Item number: ATA-APrEST75738.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: Cep112, CEP112, CCDC46, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-CE112
Anti-CE112

Item number: ELK-ES17530.100

This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate...
Keywords: Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46,...
Application: WB
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
CEP112 (human), recombinant protein
CEP112 (human), recombinant protein

Item number: ABS-PP-8008.100

Keywords: Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein
Expressed in: E.coli
Origin: human
MW: 15 kD
From 90.00€ *
Review
CEP112 PrEST Antigen
CEP112 PrEST Antigen

Item number: ATA-APrEST96046.100

PrEST Antigen CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Antigen sequence: LMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 100% Rat gene identity: 100%
Keywords: CCDC46, Cep112, CEP112, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46
Expressed in: E.coli
Origin: human
264.00€ *
Review