15 products were found matching "K16747"!
No results were found for the filter!
Anti-BBS2
Item number: ATA-HPA041315.100
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Keywords: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-BBS2
Item number: ATA-HPA040961.100
Polyclonal Antibody against Human BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Validated applications: ICC, Uniprot ID: Q9BXC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: The BBSome complex is thought to function as a...
| Keywords: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-BBS2
Item number: ATA-HPA059900.100
Polyclonal Antibody against Human BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Validated applications: ICC, Uniprot ID: Q9BXC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: The BBSome complex is thought to function as a...
| Keywords: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
BBS2 (human), recombinant protein
Item number: ABS-PP-6173-L.100
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Keywords: | Bardet-Biedl syndrome 2 protein, Recombinant Human BBS2 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 115.00€
*
BBS2 PrEST Antigen
Item number: ATA-APrEST82169.100
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Keywords: | BBS2, Bardet-Biedl syndrome 2 protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-BBS2
Item number: G-CAB7425.20
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Keywords: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | mouse, rat |
103.00€
*
Anti-BBS2
Item number: ELK-ES18093.100
This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse and...
| Keywords: | Anti-Bardet-Biedl syndrome 2 protein, BBS2 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
BBS2 (Vector Vector will be determined during the...
Item number: CSB-CL866303HU.10
Length: 2166 Sequence: atgctgctgc ctgtgttcac cctgaaactg cgccacaaaa tcagcccccg aatggtggcc atagggcgct acgacgggac tcacccgtgc ctggcggccg ccacccaaac gggcaaggtt tttattcata atcctcatac acggaaccag catgtcagtg catccagggt cttccagagc cccctggaat ctgatgtttc tcttctcaac attaaccagg cagtcagctg tctgactgca ggcgtattga accctgagct...
| Keywords: | BBS2, Bardet-Biedl syndrome 2 protein |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
482.00€
*
Anti-BBS2
Item number: CSB-PA866303ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: BBS2. Antigen Species: Human
| Keywords: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein, BBS2Bardet-Biedl syndrome 2 protein antibody, BBS2 Antibody |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 167.00€
*
Anti-BBS2
Item number: CSB-PA866303ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: BBS2. Antigen Species: Human
| Keywords: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein, BBS2Bardet-Biedl syndrome 2 protein antibody, BBS2 Antibody |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
BBS2 (human), recombinant protein
Item number: ABS-PP-6173.100
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Keywords: | Bardet-Biedl syndrome 2 protein, Recombinant Human BBS2 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 90.00€
*
BBS2 PrEST Antigen
Item number: ATA-APrEST96065.100
PrEST Antigen BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Antigen sequence: VVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: The BBSome complex is...
| Keywords: | BBS2, Bardet-Biedl syndrome 2 protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*