19 products were found matching "K14719"!

Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 92% and to rat: 88%

Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 130-233aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: WAYTCNISPG VEGQSLQRQQ QLGLWVIAGF LTFLALEKMF LNCKEEDPSQ APSKDPTAAA LNGGHCLAQP AAEPGLRAVV RNLKVSGYLN LLANTIDNFT HGLA. Purity: Greater than 90% as...

Human SLC39A13 (Zinc transporter ZIP13) ELISA Kit is a high quality kit for research use only from Assay Genie. The Human SLC39A13 (Zinc transporter ZIP13) ELISA Kit comes in a 96 Assays format and reacts against Human samples. We ship this kit on Gel Pack and kits should be stored at 2-8°C Protein Function:...

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human SLC39A13. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human SLC39A13....

Acts as a zinc-influx transporter. Source: Recombinant protein corresponding to aa130-233 from rat Slc39a13, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA,...

Anti-ZIP6 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with ZIP6 from other sources has not been determined. Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium]

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Slc39a13 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Rat and for use in ELISA applications. Slc39a13 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium]

Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.