12 products were found matching "K14458"!
No results were found for the filter!
Anti-MOGAT1
Item number: ATA-HPA049944.100
Protein function: Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence...
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol O-acyltransferase 1,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-MOGAT1
Item number: ATA-HPA076308.100
Polyclonal Antibody against Human MOGAT1, Gene description: monoacylglycerol O-acyltransferase 1, Alternative Gene Names: DGAT2L, DGAT2L1, MGAT1, Validated applications: ICC, Uniprot ID: Q96PD6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the...
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol O-acyltransferase 1,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-MOGT1, CT (MOGAT1, DC2, DGAT2L1, 2-acylglycerol...
Item number: 038533-FITC.200
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM]. Applications: Suitable for use in Western Blot,...
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-MOGAT1, EC=2.3.1.22, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol... |
| Application: | FLISA, FC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
1,104.00€
*
Anti-MOGT1, CT (MOGAT1, DC2, DGAT2L1, 2-acylglycerol...
Item number: 038533.200
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM]. Applications: Suitable for use in Western Blot,...
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-MOGAT1, EC=2.3.1.22, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol... |
| Application: | ELISA, FC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
MOGAT1 PrEST Antigen
Item number: ATA-APrEST85054.100
Protein function: Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DC2, hDC2, MGAT1, 2-acylglycerol O-acyltransferase 1, Monoacylglycerol O-acyltransferase 1, Acyl-CoA:monoacylglycerol... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-MOGT1
Item number: ELK-ES19513.100
Protein function: Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization: Endoplasmic reticulum membrane , Multi-pass...
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol O-acyltransferase 1,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Anti-MOGAT1
Item number: CSB-PA014710GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: MOGAT1. Antigen Species: Human
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol O-acyltransferase 1,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Anti-MOGAT1
Item number: CSB-PA836275LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MOGAT1. Antigen Species: Human
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol O-acyltransferase 1,... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MOGAT1, HRP conjugated
Item number: CSB-PA836275LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MOGAT1. Antigen Species: Human
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol O-acyltransferase 1,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MOGAT1, FITC conjugated
Item number: CSB-PA836275LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MOGAT1. Antigen Species: Human
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol O-acyltransferase 1,... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MOGAT1, Biotin conjugated
Item number: CSB-PA836275LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MOGAT1. Antigen Species: Human
| Keywords: | Anti-DC2, Anti-hDC2, Anti-MGAT1, Anti-2-acylglycerol O-acyltransferase 1, Anti-Monoacylglycerol O-acyltransferase 1,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
MOGAT1 PrEST Antigen
Item number: ATA-APrEST95719.100
PrEST Antigen MOGAT1, Gene description: monoacylglycerol O-acyltransferase 1, Alternative Gene Names: DGAT2L, DGAT2L1, MGAT1, Antigen sequence: GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the...
| Keywords: | DC2, hDC2, MGAT1, 2-acylglycerol O-acyltransferase 1, Monoacylglycerol O-acyltransferase 1, Acyl-CoA:monoacylglycerol... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*