- Search results for K14433
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "K14433"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA039158.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 76% and to rat: 76%
| Keywords: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1 |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: CSB-PA002190.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, ATP dependent RNA helicase DQX1... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, monkey |
From 126.00€
*
Item number: CSB-PA906253.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, ATP dependent RNA helicase DQX1... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
284.00€
*
Item number: ATA-HPA046763.100
Polyclonal Antibody against Human DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Validated applications: ICC, Uniprot ID: Q8TE96, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
| Keywords: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA046763.25
Polyclonal Antibody against Human DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Validated applications: ICC, Uniprot ID: Q8TE96, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
| Keywords: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ATA-APrEST79101.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DQX1, EC=3.6.4.12, DEAQ box polypeptide 1, ATP-dependent RNA helicase DQX1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABD-8C14660.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-DQX1 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Keywords: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, DQX1 Antibody |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
628.00€
*
Item number: ELK-ES2197.100
similarity:Contains 1 helicase ATP-binding domain.,similarity:Contains 1 helicase C-terminal domain., Recommended dilutions: Western Blot: 1/500 - 1/2000. ELISA: 1/20000. Not yet tested in other applications.. Cellular localization: Nucleus .
| Keywords: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, DQX1 rabbit pAb |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, monkey |
From 173.00€
*
Item number: ABS-PP-12215.100
| Keywords: | ATP-dependent RNA helicase DQX1, DEAQ box polypeptide 1, Recombinant Human DQX1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26.5 kD |
From 90.00€
*
Item number: ATA-APrEST96116.100
PrEST Antigen DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Antigen sequence: VSGYFLKVARDTDGTGNYLLLTHKHVAQLSSYCCYRSRRAPARPPPWVLYHNFTISKDNCLSIVSEIQPQMLVEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 85% Rat gene identity:...
| Keywords: | DQX1, EC=3.6.4.12, DEAQ box polypeptide 1, ATP-dependent RNA helicase DQX1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-12215-L.100
| Keywords: | ATP-dependent RNA helicase DQX1, DEAQ box polypeptide 1, Recombinant Human DQX1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26.5 kD |
From 115.00€
*