24 products were found matching "K13217"!
No results were found for the filter!
Anti-PRPF39
Item number: ATA-HPA078403.100
Polyclonal Antibody against Human PRPF39, Gene description: pre-mRNA processing factor 39, Alternative Gene Names: FLJ11128, FLJ20666, Validated applications: ICC, Uniprot ID: Q86UA1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in pre-mRNA...
| Keywords: | Anti-PRPF39, Anti-PRP39 homolog, Anti-Pre-mRNA-processing factor 39 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-PRPF39
Item number: CSB-PA103635.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-PRPF39, Anti-PRP39 homolog, Anti-Pre-mRNA-processing factor 39, FLJ11128 antibody, FLJ20666 antibody, FLJ45460... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
283.00€
*
Anti-PRPF39
Item number: ATA-HPA001176.100
Protein function: Involved in pre-mRNA splicing. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 99% and to rat: 98%
| Keywords: | Anti-PRPF39, Anti-PRP39 homolog, Anti-Pre-mRNA-processing factor 39 |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 358.00€
*
Anti-PRPF39
Item number: ARG43976.50
Protein function: Involved in pre-mRNA splicing. [The UniProt Consortium]
| Keywords: | Anti-PRPF39, Anti-PRP39 homolog, Anti-PRP39 homolog, Anti-Pre-mRNA-processing factor 39, Anti-Pre-mRNA-processing factor 39 |
| Application: | ELISA, FC, ICC, IF, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
551.00€
*
Anti-PRPF39
Item number: ELK-ES6691.100
function:Involved in pre-mRNA splicing.,similarity:Belongs to the PRP39 family.,similarity:Contains 7 HAT repeats., Protein function: Involved in pre-mRNA splicing. [The UniProt Consortium] Recommended dilutions: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/40000. Not yet tested in...
| Keywords: | Anti-PRPF39, Anti-PRP39 homolog, Anti-Pre-mRNA-processing factor 39, PRPF39 rabbit pAb |
| Application: | WB, IHC, IF, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Anti-PRP39
Item number: CSB-PA018767XA01SVG.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-PRP39, Anti-YML046W, Anti-YM9827.06, Anti-Pre-mRNA-processing factor 39, PRP39 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
From 1,529.00€
*
Anti-prp39
Item number: CSB-PA018767XA01SXV.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-prp39, Anti-SPBC4B4.09, Anti-Pre-mRNA-processing factor 39, prp39 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
From 1,529.00€
*
Anti-CG1646
Item number: CSB-PA745323XA01DLU.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-PRP39 homolog, Anti-Pre-mRNA-processing factor 39, CG1646 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Drosophila melanogaster (Fruit fly) |
From 1,529.00€
*
Anti-prpf39
Item number: CSB-PA629046XA01DIL.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-prpf39, Anti-PRP39 homolog, Anti-Pre-mRNA-processing factor 39, prpf39 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Danio rerio (Zebrafish) (Brachydanio rerio) |
From 1,529.00€
*
Anti-PRP42
Item number: CSB-PA785979XA01SVG.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-PRP42, Anti-MUD16, Anti-YDR235W, Anti-YD8419.02, Anti-65 kDa snRNP protein, Anti-U1 snRNP protein PRP42,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
From 1,529.00€
*
PRPF39 (human), recombinant protein
Item number: ABS-PP-2398.20
| Keywords: | Pre-mRNA-processing factor 39, PRP39 homolog, Recombinant Human PRPF39 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 17.5 kD |
From 90.00€
*
PRPF39 PrEST Antigen
Item number: ATA-APrEST95775.100
PrEST Antigen PRPF39, Gene description: pre-mRNA processing factor 39, Alternative Gene Names: FLJ11128, FLJ20666, Antigen sequence: GDLKQNEENILNCFDKAVHGSLPIKMRITFSQRKVEFLEDFGSDVNKLLNAYDEHQTLLKEQDSLKRKAENGSEEPEEKKAHTEDTTSSSTQMIDGDLQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | PRPF39, PRP39 homolog, Pre-mRNA-processing factor 39 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*