12 products were found matching "K12307"!
No results were found for the filter!
Anti-MFSD8
Item number: ATA-HPA044802.100
Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 66% and to rat: 66%
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 330.00€
*
Anti-MFSD8
Item number: G-PACO39166.50
MFSD8 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. MFSD8 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The...
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Major facilitator superfamily domain-containing protein 8...
Item number: CSB-EP844087HU1.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-40aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: MAGLRNESEQ EPLLGDTPGS REWDILETEE HYKSRWRSIR. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form:...
| Keywords: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 34.8 kD |
From 292.00€
*
MFSD8, Recombinant, Human, aa1-40, His-GST-Tag (Major...
Item number: 374200.100
May be a carrier that transport small solutes by using chemiosmotic ion gradients. Source: Recombinant protein corresponding to aa1-40 from human MFSD8, fused to His-GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~34.8kD, AA Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR, Storage and Stability:...
| Keywords: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| MW: | 34,8 |
From 690.00€
*
MFSD8 PrEST Antigen
Item number: ATA-APrEST84093.100
Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-MFSD8
Item number: ELK-ES11413.100
This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The...
| Keywords: | Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing protein 8, MFSD8... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
MFSD8 (Vector Vector will be determined during the...
Item number: CSB-CL844087HU.10
Length: 1557 Sequence: atggccggcc tgcggaacga aagtgaacag gagccgctct taggcgacac acctggaagc agagaatggg acattttaga gactgaagag cattataaga gccgatggag atctattagg attttatatc ttactatgtt tctcagcagt gtagggtttt ctgtagtgat gatgtccata tggccatatc tccaaaagat tgatccgaca gctgatacaa gttttttggg ctgggttatt gcttcatata gtcttggcca...
| Keywords: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
357.00€
*
Anti-MFSD8
Item number: CSB-PA844087LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MFSD8, HRP conjugated
Item number: CSB-PA844087LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MFSD8, FITC conjugated
Item number: CSB-PA844087LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MFSD8, Biotin conjugated
Item number: CSB-PA844087LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-mfsd8
Item number: CSB-PA611727XA01DIL.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-mfsd8, Anti-Major facilitator superfamily domain-containing protein 8, mfsd8 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Danio rerio (Zebrafish) (Brachydanio rerio) |
From 1,529.00€
*