- Search results for K11666
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "K11666"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA070644.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 95% and to rat: 96%
| Keywords: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA078274.100
Polyclonal Antibody against Human INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Validated applications: ICC, Uniprot ID: Q9C086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Keywords: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA078274.25
Polyclonal Antibody against Human INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Validated applications: ICC, Uniprot ID: Q9C086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Keywords: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: VHPS-4177
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Application: | RNA quantification |
45.00€
*
Item number: 037040.200
IN80B induces growth and cell cycle arrests at the G1 phase of the cell cycle. Applications: Suitable for use in Western Blot, Flow Cytometry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Flow Cytometry: 1:10-50, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
| Keywords: | Anti-hIes2, Anti-INO80B, Anti-PAPA-1, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Application: | ELISA, FC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST94334.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ARG44454.50
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Keywords: | Anti-hIes2, Anti-hIes2, Anti-INO80B, Anti-PAPA-1, Anti-PAPA-1, Anti-HMGA1L4, Anti-IES2 homolog, Anti-IES2 homolog,... |
| Application: | FC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
551.00€
*
Item number: CSB-CL011725HU.10
Length: 1032 Sequence: atggaggccc ctgagccggg agaagccctg gagttgagcc tggcgggtgc ccatggccat ggagtgcaca agaaaaaaca caagaagcac aagaagaaac acaagaagaa acaccatcag gaagaagacg ccgggcccac gcagccgtcc cctgccaagc ctcagctcaa actcaaaatc aagcttgggg gacaagtcct ggggaccaag agtgttccta ccttcactgt gatcccagag gggcctcgct caccctctcc...
| Keywords: | hIes2, INO80B, PAPA-1, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
386.00€
*
Item number: ABS-PP-10455.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Keywords: | INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, hIes2, PAP-1-associated protein 1, PAPA-1,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 24.5 kD |
From 90.00€
*
Item number: ATA-APrEST95967.100
PrEST Antigen INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Antigen sequence: HKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: NSJ-RQ8607
0.5mg/ml if reconstituted with 0.2ml sterile DI water. INO80 complex subunit B is a protein that in humans is encoded by the INO80B gene. This gene encodes a subunit of an ATP-dependent chromatin remodeling complex, INO80, which plays a role in DNA and nucleosome-activated ATPase activity and ATP-dependent...
| Keywords: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Application: | WB, FC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
790.00€
*
Item number: ABS-PP-10455-L.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Keywords: | INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, hIes2, PAP-1-associated protein 1, PAPA-1,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 24.5 kD |
From 115.00€
*