8 products were found matching "K09547"!

Polyclonal Antibody against Human HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Validated applications: ICC, Uniprot ID: Q9BQS6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 55% Rat gene identity:...

Polyclonal Antibody against Human HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Validated applications: ICC, Uniprot ID: Q9BQS6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 55% Rat gene identity:...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

The function of this protein remains unknown. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for...

similarity:Belongs to the small heat shock protein (HSP20) family.,tissue specificity:Testis specific., Recommended dilutions: WB 1:500-2000 ELISA 1:5000-20000. Cellular localization: Cytoplasm . Nucleus . Translocates to nuclear foci during heat shock.

PrEST Antigen HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Antigen sequence: TGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 55% Rat...