16 products were found matching "K03377"!

1 from 2 pages
No results were found for the filter!
Anti-CASD1
Anti-CASD1

Item number: ATA-HPA044404.100

Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
Keywords: Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,...
Application: ICC, IHC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
CAS1 domain-containing protein 1 (CASD1), partial, human, recombinant
CAS1 domain-containing protein 1 (CASD1), partial, human,...

Item number: CSB-EP846683HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 39-313aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: ASRRYRGNDS CEYLLSSGRF LGEKVWQPHS CMMHKYKISE AKNCLVDKHI AFIGDSRIRQ LFYSFVKIIN PQFKEEGNKH ENIPFEDKTA SVKVDFLWHP EVNGSMKQCI KVWTEDSIAK PHVIVAGAAT...
Keywords: SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate...
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 47.2 kD
From 219.00€ *
Review
Anti-CASD1
Anti-CASD1

Item number: ATA-HPA052908.100

Polyclonal Antibody against Human CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Validated applications: IHC, Uniprot ID: Q96PB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: O-acetyltransferase...
Keywords: Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,...
Application: IHC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-CASD1
Anti-CASD1

Item number: ATA-HPA052908.25

Polyclonal Antibody against Human CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Validated applications: IHC, Uniprot ID: Q96PB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: O-acetyltransferase...
Keywords: Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,...
Application: IHC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
Anti-CASD1, NT (CAS1 Domain-containing Protein 1, C7orf12, Nbla04196) (Azide free) (APC)
Anti-CASD1, NT (CAS1 Domain-containing Protein 1,...

Item number: C2084-10-APC.200

Applications: , Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-1:500, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
Keywords: Anti-CASD1, Anti-C7orf12, Anti-Nbla04196, Anti-CAS1 domain-containing protein 1
Application: FLISA, WB
Host: Rabbit
Species reactivity: human, mouse
1,104.00€ *
Review
Anti-CASD1, NT (CAS1 Domain-containing Protein 1, C7orf12, Nbla04196)
Anti-CASD1, NT (CAS1 Domain-containing Protein 1,...

Item number: C2084-10.200

Applications: , Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-1:500, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
Keywords: Anti-CAS1 domain-containing protein 1
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse
865.00€ *
Review
CASD1, Recombinant, Human, aa39-313, His-SUMO-Tag (CAS1 Domain-containing Protein 1)
CASD1, Recombinant, Human, aa39-313, His-SUMO-Tag (CAS1...

Item number: 372576.1

Source:, Recombinant protein corresponding to aa39-313 from human CASD1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.2kD, AA Sequence:...
Keywords: SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate...
MW: 47,2
From 603.00€ *
Review
CASD1 PrEST Antigen
CASD1 PrEST Antigen

Item number: ATA-APrEST74963.100

Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
Keywords: SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate...
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
CASD1 (human), recombinant protein
CASD1 (human), recombinant protein

Item number: ABS-PP-3125.100

Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
Keywords: N-acetylneuraminate 9-O-acetyltransferase, CAS1 domain-containing protein 1, Sialate O-acetyltransferase, SOAT,...
Expressed in: E.coli
Origin: human
MW: 17.5 kD
From 90.00€ *
Review
CASD1 PrEST Antigen
CASD1 PrEST Antigen

Item number: ATA-APrEST95904.100

PrEST Antigen CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Antigen sequence: LNSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRETTAMILMNVYCNKILKPVDGSCCQPRPPVTL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate...
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-RWA1
Anti-RWA1

Item number: CSB-PA184394XA01DOA.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-Protein REDUCED WALL ACETYLATION 1, RWA1 Antibody
Application: ELISA, WB
Host: Rabbit
Species reactivity: Arabidopsis thaliana (Mouse-ear cress)
From 1,529.00€ *
Review
Anti-RWA4
Anti-RWA4

Item number: CSB-PA266132XA01DOA.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-Protein REDUCED WALL ACETYLATION 4, RWA4 Antibody
Application: ELISA, WB
Host: Rabbit
Species reactivity: Arabidopsis thaliana (Mouse-ear cress)
From 1,529.00€ *
Review
1 from 2 pages