- Search results for K03377
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
16 products were found matching "K03377"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA044404.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Keywords: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: CSB-EP846683HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 39-313aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: ASRRYRGNDS CEYLLSSGRF LGEKVWQPHS CMMHKYKISE AKNCLVDKHI AFIGDSRIRQ LFYSFVKIIN PQFKEEGNKH ENIPFEDKTA SVKVDFLWHP EVNGSMKQCI KVWTEDSIAK PHVIVAGAAT...
| Keywords: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 47.2 kD |
From 219.00€
*
Item number: ATA-HPA052908.100
Polyclonal Antibody against Human CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Validated applications: IHC, Uniprot ID: Q96PB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: O-acetyltransferase...
| Keywords: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA052908.25
Polyclonal Antibody against Human CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Validated applications: IHC, Uniprot ID: Q96PB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: O-acetyltransferase...
| Keywords: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: C2084-10-APC.200
Applications: , Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-1:500, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
| Keywords: | Anti-CASD1, Anti-C7orf12, Anti-Nbla04196, Anti-CAS1 domain-containing protein 1 |
| Application: | FLISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
1,104.00€
*
Item number: C2084-10.200
Applications: , Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-1:500, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
| Keywords: | Anti-CAS1 domain-containing protein 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
865.00€
*
Item number: 372576.1
Source:, Recombinant protein corresponding to aa39-313 from human CASD1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.2kD, AA Sequence:...
| Keywords: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| MW: | 47,2 |
From 603.00€
*
Item number: ATA-APrEST74963.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Keywords: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-3125.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Keywords: | N-acetylneuraminate 9-O-acetyltransferase, CAS1 domain-containing protein 1, Sialate O-acetyltransferase, SOAT,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 17.5 kD |
From 90.00€
*
Item number: ATA-APrEST95904.100
PrEST Antigen CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Antigen sequence: LNSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRETTAMILMNVYCNKILKPVDGSCCQPRPPVTL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: CSB-PA184394XA01DOA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-Protein REDUCED WALL ACETYLATION 1, RWA1 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Arabidopsis thaliana (Mouse-ear cress) |
From 1,529.00€
*
Item number: CSB-PA266132XA01DOA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-Protein REDUCED WALL ACETYLATION 4, RWA4 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Arabidopsis thaliana (Mouse-ear cress) |
From 1,529.00€
*