34 products were found matching "K02978"!
No results were found for the filter!
Anti-MPS1 / RPS27, N-terminal
Item number: ARG63311.100
| Keywords: | Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Application: | ELISA, WB |
| Host: | Goat |
| Species reactivity: | human |
871.00€
*
Anti-MPS1
Item number: NSJ-R35054-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Metallopanstimulin 1, RPS27, Ribosomal protein S27, RPS27
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, MPS1 Antibody |
| Application: | WB, ELISA (peptide), IHC (paraffin) |
| Host: | Goat |
| Species reactivity: | human |
836.00€
*
Anti-RPS27L
Item number: E-AB-18756.120
This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. RPS27L (Ribosomal Protein S27 Like) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA...
| Keywords: | Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like, RPS27L Polyclonal Antibody |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 89.00€
*
Anti-RPS27L
Item number: ATA-HPA066851.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
| Keywords: | Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-RPS27L
Item number: CSB-PA004000.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like, RPS27L antibody, 40S ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 126.00€
*
Anti-RPS27
Item number: CSB-PA346286.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Anti-RPS27
Item number: CSB-PA445027.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
RPS27, Recombinant, Human, aa1-84, GST-Tag (40S Ribosomal...
Item number: 375142.100
Source:, Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | MPS1, MPS-1, RPS27, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27 |
| MW: | 36,3 |
From 690.00€
*
RPS27 (human), recombinant protein
Item number: ABS-PP-10806-L.100
Protein function: Component of the small ribosomal subunit (PubMed:8706699). Required for proper rRNA processing and maturation of 18S rRNAs (PubMed:25424902). [The UniProt Consortium]
| Keywords: | Small ribosomal subunit protein eS27, 40S ribosomal protein S27, Metallopan-stimulin 1, MPS-1, Recombinant Human RPS27... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 115.00€
*
RPS27L (human), recombinant protein
Item number: ABS-PP-10879-L.100
| Keywords: | Ribosomal protein eS27-like, 40S ribosomal protein S27-like, Small ribosomal subunit protein eS27-like, Recombinant Human... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 115.00€
*
Anti-rps27
Item number: CSB-PA020419XA01SXV.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-rps27, Anti-SPBC1685.10, Anti-40S ribosomal protein S27, Anti-Small ribosomal subunit protein eS27, rps27 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
1,529.00€
*
Anti-RPS27A
Item number: CSB-PA327472XA01SVG.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-RP61, Anti-YS20, Anti-YKL156W, Anti-40S ribosomal protein S27-A, Anti-Small ribosomal subunit protein eS27A, RPS27A... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
From 1,529.00€
*