- Search results for K02978
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
34 products were found matching "K02978"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG63311.100
| Keywords: | Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Application: | ELISA, WB |
| Host: | Goat |
| Species reactivity: | human |
871.00€
*
Item number: NSJ-R35054-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Metallopanstimulin 1, RPS27, Ribosomal protein S27, RPS27
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, MPS1 Antibody |
| Application: | WB, ELISA (peptide), IHC (paraffin) |
| Host: | Goat |
| Species reactivity: | human |
836.00€
*
Item number: E-AB-18756.120
This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. RPS27L (Ribosomal Protein S27 Like) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA...
| Keywords: | Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like, RPS27L Polyclonal Antibody |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 89.00€
*
Item number: ATA-HPA066851.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
| Keywords: | Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: CSB-PA004000.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like, RPS27L antibody, 40S ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 126.00€
*
Item number: CSB-PA346286.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: CSB-PA445027.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: E-AB-91301.120
This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.
| Keywords: | Ribosomal protein eS27-like, 40S ribosomal protein S27-like, Small ribosomal subunit protein eS27-like, RPS27L Polyclonal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 243.00€
*
Item number: 375142.100
Source:, Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | MPS1, MPS-1, RPS27, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27 |
| MW: | 36,3 |
From 690.00€
*
Item number: VHPS-7999
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | RPS27L, 40S ribosomal protein S27-like |
| Application: | RNA quantification |
45.00€
*
Item number: VMPS-5588
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | Rps27l, 40S ribosomal protein S27-like |
| Application: | RNA quantification |
45.00€
*
Item number: 030453.100
MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Application: | ELISA, IHC |
| Host: | Mouse |
| Species reactivity: | human |
754.00€
*