34 products were found matching "K02978"!

1 from 3 pages
No results were found for the filter!
Anti-MPS1 / RPS27, N-terminal
Anti-MPS1 / RPS27, N-terminal

Item number: ARG63311.100

Keywords: Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27
Application: ELISA, WB
Host: Goat
Species reactivity: human
871.00€ *
Review
Anti-MPS1
Anti-MPS1

Item number: NSJ-R35054-100UG

0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Metallopanstimulin 1, RPS27, Ribosomal protein S27, RPS27
Keywords: Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, MPS1 Antibody
Application: WB, ELISA (peptide), IHC (paraffin)
Host: Goat
Species reactivity: human
836.00€ *
Review
Anti-RPS27L
Anti-RPS27L

Item number: E-AB-18756.120

This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. RPS27L (Ribosomal Protein S27 Like) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA...
Keywords: Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like, RPS27L Polyclonal Antibody
Application: WB, IHC, ELISA
Host: Rabbit
Species reactivity: human, mouse, rat
From 89.00€ *
Review
Anti-RPS27L
Anti-RPS27L

Item number: ATA-HPA066851.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
Keywords: Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like
Application: ICC, WB
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-RPS27L
Anti-RPS27L

Item number: CSB-PA004000.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-40S ribosomal protein S27-like, Anti-Small ribosomal subunit protein eS27-like, RPS27L antibody, 40S ribosomal...
Application: ELISA, WB, IHC
Host: Rabbit
Species reactivity: human, mouse
From 126.00€ *
Review
Anti-RPS27
Anti-RPS27

Item number: CSB-PA346286.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
Keywords: Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal...
Application: ELISA, WB, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 167.00€ *
Review
Anti-RPS27
Anti-RPS27

Item number: CSB-PA445027.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
Keywords: Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
From 167.00€ *
Review
RPS27, Recombinant, Human, aa1-84, GST-Tag (40S Ribosomal Protein S27)
RPS27, Recombinant, Human, aa1-84, GST-Tag (40S Ribosomal...

Item number: 375142.100

Source:, Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH, Storage and Stability: May be stored at 4°C for short-term only....
Keywords: MPS1, MPS-1, RPS27, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27
MW: 36,3
From 690.00€ *
Review
RPS27 (human), recombinant protein
RPS27 (human), recombinant protein

Item number: ABS-PP-10806-L.100

Protein function: Component of the small ribosomal subunit (PubMed:8706699). Required for proper rRNA processing and maturation of 18S rRNAs (PubMed:25424902). [The UniProt Consortium]
Keywords: Small ribosomal subunit protein eS27, 40S ribosomal protein S27, Metallopan-stimulin 1, MPS-1, Recombinant Human RPS27...
Expressed in: E.coli
Origin: human
MW: 10.5 kD
From 115.00€ *
Review
RPS27L (human), recombinant protein
RPS27L (human), recombinant protein

Item number: ABS-PP-10879-L.100

Keywords: Ribosomal protein eS27-like, 40S ribosomal protein S27-like, Small ribosomal subunit protein eS27-like, Recombinant Human...
Expressed in: E.coli
Origin: human
MW: 10.5 kD
From 115.00€ *
Review
Anti-rps27
Anti-rps27

Item number: CSB-PA020419XA01SXV.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-rps27, Anti-SPBC1685.10, Anti-40S ribosomal protein S27, Anti-Small ribosomal subunit protein eS27, rps27 Antibody
Application: ELISA, WB
Host: Rabbit
Species reactivity: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
1,529.00€ *
Review
Anti-RPS27A
Anti-RPS27A

Item number: CSB-PA327472XA01SVG.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-RP61, Anti-YS20, Anti-YKL156W, Anti-40S ribosomal protein S27-A, Anti-Small ribosomal subunit protein eS27A, RPS27A...
Application: ELISA, WB
Host: Rabbit
Species reactivity: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
From 1,529.00€ *
Review
1 from 3 pages