28 products were found matching "K02929"!
No results were found for the filter!
Anti-RPL36AL
Item number: ARG40081.100
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
707.00€
*
Anti-RPL36A
Item number: ATA-HPA077586.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
| Keywords: | Anti-GIG15, Anti-RPL44, Anti-RPL36A, Anti-60S ribosomal protein L44, Anti-60S ribosomal protein L36a, Anti-Large ribosomal... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
60S ribosomal protein L36a-like (RPL36AL), human,...
Item number: CSB-RP018044h.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-106aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MVNVPKTRRT FCKKCGKHQP HKVTQYKKGK DSLYAQGRRR YDRKQSGYGG QTKPIFRKKA KTTKKIVLRL ECVEPNCRSK RMLAIKRCKH FELGGDKKRK GQVIQF. Purity: Greater than 90% as...
| Keywords: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human 60S ribosomal... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 39.5 kD |
From 219.00€
*
Anti-RPL36AL
Item number: CSB-PA01804A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-RPL36AL
Item number: CSB-PA01805A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
NEW
Anti-RPL44
Item number: CSB-PA748350XA01DOT.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-RPL44, Anti-AFR034W, Anti-60S ribosomal protein L44, Anti-Large ribosomal subunit protein eL42, RPL44 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
1,529.00€
*
RPL36AL (human), recombinant protein
Item number: ABS-PP-10782-L.100
| Keywords: | Ribosomal protein eL42-like, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 13 kD |
From 115.00€
*
Anti-RPL36A, CT (RPL36A, RPL44, 60S ribosomal protein...
Item number: 041212.200
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Keywords: | Anti-GIG15, Anti-RPL44, Anti-RPL36A, Anti-60S ribosomal protein L44, Anti-60S ribosomal protein L36a, Anti-Cell... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S...
Item number: 375106.1
Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD, AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF,...
| Keywords: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like |
| MW: | 39,5 |
From 603.00€
*
RPL36A PrEST Antigen
Item number: ATA-APrEST90521.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | GIG15, RPL44, RPL36A, 60S ribosomal protein L44, 60S ribosomal protein L36a, Large ribosomal subunit protein eL42, Cell... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-RPL36AL
Item number: G-CAB14366.20
RPL36AL Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in WB IF applications.RPL36AL Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like |
| Application: | WB, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
103.00€
*
Anti-RL36L
Item number: ELK-ES9327.100
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Keywords: | Anti-RPL36AL, Anti-Ribosomal protein eL42-like, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*