5 products were found matching "K02916"!
No results were found for the filter!
Anti-MRPL35
Item number: G-PACO07202.50
MRPL35 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB applications. MRPL35 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-L35mt, Anti-MRPL35, Anti-BM-007, Anti-MRP-L35, Anti-39S ribosomal protein L35, mitochondrial, Anti-Mitochondrial... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
320.00€
*
Anti-MRPL35
Item number: ATA-HPA043482.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 61%
| Keywords: | Anti-L35mt, Anti-MRPL35, Anti-BM-007, Anti-MRP-L35, Anti-39S ribosomal protein L35, mitochondrial, Anti-Mitochondrial... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 335.00€
*
Anti-MRP-L35
Item number: ELK-ES8354.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-L35mt, Anti-BM-007, Anti-MRPL35, Anti-MRP-L35, Anti-Large ribosomal subunit protein bL35m, Anti-39S ribosomal protein... |
| Application: | WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 169.00€
*
MRPL35 PrEST Antigen
Item number: ATA-APrEST84685.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L35mt, MRPL35, BM-007, MRP-L35, 39S ribosomal protein L35, mitochondrial, Mitochondrial large ribosomal subunit protein bL35m |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
247.00€
*
RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S...
Item number: 375128.100
Source:, Recombinant protein corresponding to aa7-64 from E. coli 50S Ribosomal Protein L35, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.5kD, AA Sequence: VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | rpmI, b1717, Ribosomal protein A, 50S ribosomal protein L35, Large ribosomal subunit protein bL35 |
| MW: | 33,5 |
From 636.00€
*
