36 products were found matching "K02916"!
No results were found for the filter!
Anti-MRPL35
Item number: ATA-HPA077961.100
Rabbit Polyclonal MRPL35 Antibody against Human mitochondrial ribosomal protein L35. Validated for Western Blot. Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Interspecies information: Highest antigen sequence indentity to the following orthologs: ENSMUSG00000052962: 87%,...
| Keywords: | Anti-L35mt, Anti-BM-007, Anti-MRPL35, Anti-MRP-L35, Anti-39S ribosomal protein L35, mitochondrial, Anti-Mitochondrial... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-MRPL35
Item number: G-PACO07202.50
MRPL35 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB applications. MRPL35 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-L35mt, Anti-MRPL35, Anti-BM-007, Anti-MRP-L35, Anti-39S ribosomal protein L35, mitochondrial, Anti-Mitochondrial... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
225.00€
*
Anti-MRPL35
Item number: ATA-HPA043482.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 61%
| Keywords: | Anti-L35mt, Anti-MRPL35, Anti-BM-007, Anti-MRP-L35, Anti-39S ribosomal protein L35, mitochondrial, Anti-Mitochondrial... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
50S ribosomal protein L35 (rpmI), partial, Escherichia...
Item number: CSB-RP088044Ba.1
Organism: Escherichia coli (strain K12). Source: E.coli. Expression Region: 7-64aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VRGAAKRFKK TGKGGFKHKH ANLRHILTKK ATKRKRHLRP KAMVSKGDLG LVIACLPY. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological...
| Keywords: | rpmI, b1717, Ribosomal protein A, 50S ribosomal protein L35, Large ribosomal subunit protein bL35, Recombinant Escherichia... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | E.coli |
| MW: | 33.5 kD |
From 364.00€
*
Anti-MRPL35
Item number: CSB-PA473419.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-L35mt, Anti-MRPL35, Anti-BM-007, Anti-MRP-L35, Anti-39S ribosomal protein L35, mitochondrial, Anti-Mitochondrial... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 126.00€
*
Anti-mRpL35
Item number: CSB-PA843122XA01DLU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-L35mt, Anti-mRpL35, Anti-CG13410, Anti-MRP-L35, Anti-Large ribosomal subunit protein bL35m, Anti-39S ribosomal... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Drosophila melanogaster (Fruit fly) |
1,529.00€
*
Anti-rpmI
Item number: CSB-PA483933XA01EOB.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-E2348C_1846, Anti-50S ribosomal protein L35, Anti-Large ribosomal subunit protein bL35, rpmI Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Escherichia coli O127:H6 (strain E2348/69 / EPEC) |
1,529.00€
*
Anti-rpmI
Item number: CSB-PA485883XA01EOR.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-EFER_1349, Anti-50S ribosomal protein L35, Anti-Large ribosomal subunit protein bL35, rpmI Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) |
1,529.00€
*
MRPL35 PrEST Antigen
Item number: ATA-APrEST84685.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L35mt, MRPL35, BM-007, MRP-L35, 39S ribosomal protein L35, mitochondrial, Mitochondrial large ribosomal subunit protein bL35m |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S...
Item number: 375128.100
Source:, Recombinant protein corresponding to aa7-64 from E. coli 50S Ribosomal Protein L35, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.5kD, AA Sequence: VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | rpmI, b1717, Ribosomal protein A, 50S ribosomal protein L35, Large ribosomal subunit protein bL35 |
| MW: | 33,5 |
From 786.00€
*
Anti-MRP-L35
Item number: ELK-ES8354.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-L35mt, Anti-BM-007, Anti-MRPL35, Anti-MRP-L35, Anti-Large ribosomal subunit protein bL35m, Anti-39S ribosomal protein... |
| Application: | WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
MRPL35 (Vector Vector will be determined during the...
Item number: CSB-CL865189HU.10
Length: 513 Sequence: atggctgcct ctgcctttgc tggtgcagtg agagcagctt caggaatcct acggtccctg aatattttga catcttcaac ctaccgcaac tgtgtcaaga atgcctctct tatttctgca ttgtccactg gacgttttag tcatattcag acaccagttg tttcctccac tcccagactt accacatctg agagaaacct gacatgtggg catacctcag tgatccttaa tagaatggcc cccgtgcttc caagtgtcct...
| Keywords: | L35mt, BM-007, MRPL35, MRP-L35, 39S ribosomal protein L35, mitochondrial, Mitochondrial large ribosomal subunit protein bL35m |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*