11 products were found matching "GeneID 93273"!

No results were found for the filter!
Anti-LEMD1
Anti-LEMD1

Item number: G-PACO61394.50

LEMD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LEMD1 Antibody is a high quality polyclonal antibody for research use only.
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Application: ELISA, IHC, IF
Host: Rabbit
Species reactivity: human
313.00€ *
Review
Anti-LEMD1
Anti-LEMD1

Item number: ATA-HPA076708.100

Polyclonal Antibody against Human LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Validated applications: ICC, Uniprot ID: Q68G75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 75% Rat gene identity: 75%
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
NEW
Anti-LEMD1
Anti-LEMD1

Item number: ATA-HPA076708.25

Polyclonal Antibody against Human LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Validated applications: ICC, Uniprot ID: Q68G75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 75% Rat gene identity: 75%
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
Anti-LEMD1
Anti-LEMD1

Item number: 600-401-CJ1

Anti-LEMD1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. At least six isoforms of LEMD1 are known to exist, this antibody will detect the longest isoform. LEMD1 antibody is predicted to not cross-react with LEMD2 and LEMD3.
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse
848.00€ *
Review
Anti-LEMD1
Anti-LEMD1

Item number: ELK-ES19585.100

Recommended dilutions: WB 1:1000-2000. Cellular localization: Membrane , Single-pass membrane protein .
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Application: WB
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
LEMD1 (Vector pUC, Accession No. BC036636)
LEMD1 (Vector pUC, Accession No. BC036636)

Item number: CSB-CL715035HU.10

Length: 546 Sequence: atggtggatg tgaagtgtct gagtgactgt aaattgcaga accaacttga gaagcttgga ttttcacctg gcccaatact accttccacc agaaagttgt atgaaaaaaa gttagtacag ttgttggtct cacctccctg tgcaccacct gtgatgaatg gacccagaga gctggatgga gcgcaggaca gtgatgacag cgaagagctt aatatcattt tgcaaggaaa tatcatactc tcaacaaaaa aaagcaagaa...
Keywords: CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1
Application: Molecular biology, clone
Species reactivity: human
213.00€ *
Review
Anti-LEMD1, HRP conjugated
Anti-LEMD1, HRP conjugated

Item number: CSB-PA715035LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-LEMD1, Biotin conjugated
Anti-LEMD1, Biotin conjugated

Item number: CSB-PA715035LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-LEMD1
Anti-LEMD1

Item number: CSB-PA715035LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Application: ELISA, IHC, IF
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-LEMD1, FITC conjugated
Anti-LEMD1, FITC conjugated

Item number: CSB-PA715035LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
Keywords: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
LEMD1 PrEST Antigen
LEMD1 PrEST Antigen

Item number: ATA-APrEST95935.100

PrEST Antigen LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Antigen sequence: DVKCLSDCKLQNQLEKLGFSPGPILPSTRKLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 75% Rat gene identity: 75%
Keywords: CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1
Expressed in: E.coli
Origin: human
264.00€ *
Review