10 products were found matching "GeneID 93273"!
No results were found for the filter!
Anti-LEMD1
Item number: G-PACO61394.50
LEMD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LEMD1 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Anti-LEMD1
Item number: ATA-HPA076708.100
Polyclonal Antibody against Human LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Validated applications: ICC, Uniprot ID: Q68G75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 75% Rat gene identity: 75%
| Keywords: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-LEMD1
Item number: 600-401-CJ1
Anti-LEMD1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. At least six isoforms of LEMD1 are known to exist, this antibody will detect the longest isoform. LEMD1 antibody is predicted to not cross-react with LEMD2 and LEMD3.
| Keywords: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
848.00€
*
Anti-LEMD1
Item number: ELK-ES19585.100
Recommended dilutions: WB 1:1000-2000. Cellular localization: Membrane , Single-pass membrane protein .
| Keywords: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
LEMD1 (Vector pUC, Accession No. BC036636)
Item number: CSB-CL715035HU.10
Length: 546 Sequence: atggtggatg tgaagtgtct gagtgactgt aaattgcaga accaacttga gaagcttgga ttttcacctg gcccaatact accttccacc agaaagttgt atgaaaaaaa gttagtacag ttgttggtct cacctccctg tgcaccacct gtgatgaatg gacccagaga gctggatgga gcgcaggaca gtgatgacag cgaagagctt aatatcattt tgcaaggaaa tatcatactc tcaacaaaaa aaagcaagaa...
| Keywords: | CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
213.00€
*
Anti-LEMD1, HRP conjugated
Item number: CSB-PA715035LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Keywords: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LEMD1, Biotin conjugated
Item number: CSB-PA715035LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Keywords: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LEMD1
Item number: CSB-PA715035LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Keywords: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LEMD1, FITC conjugated
Item number: CSB-PA715035LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Keywords: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
LEMD1 PrEST Antigen
Item number: ATA-APrEST95935.100
PrEST Antigen LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Antigen sequence: DVKCLSDCKLQNQLEKLGFSPGPILPSTRKLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 75% Rat gene identity: 75%
| Keywords: | CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*