- Search results for GeneID 9277
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "GeneID 9277"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA043004.100
Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to...
| Keywords: | Anti-FP221, Anti-BING4, Anti-WDR46, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: NSJ-RQ7402
0.5mg/ml if reconstituted with 0.2ml sterile DI water. WD repeat-containing protein 46 is a protein that in humans is encoded by the WDR46 gene. Enables RNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Predicted to be located...
| Keywords: | Anti-FP221, Anti-WDR46, Anti-BING4, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4, WDR46... |
| Application: | WB, FC, Direct ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
790.00€
*
Item number: ATA-HPA055425.100
Polyclonal Antibody against Human WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Validated applications: ICC, Uniprot ID: O15213, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Scaffold component of the...
| Keywords: | Anti-WDR46, Anti-BING4, Anti-FP221, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA055425.25
Polyclonal Antibody against Human WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Validated applications: ICC, Uniprot ID: O15213, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Scaffold component of the...
| Keywords: | Anti-WDR46, Anti-BING4, Anti-FP221, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: VHPS-1322
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | WDR46, BING4, FP221, WD repeat-containing protein 46, WD repeat-containing protein BING4 |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST82937.100
Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | FP221, BING4, WDR46, WD repeat-containing protein 46, WD repeat-containing protein BING4 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: CSB-CL026034HU.10
Length: 1833 Sequence: atggagacag cccccaagcc gggcaaggat gtcccgccca agaaagacaa acttcagacc aagagaaaga aaccgcggcg atactgggag gaagagaccg ttccgaccac agccggagcc tctccagggc ctcctcgtaa caagaagaat cgggagctcc gtcctcagag accaaaaaat gcttacatct taaagaagtc tcggatctct aagaagcctc aggtcccgaa gaaaccccga gaatggaaga acccggagtc...
| Keywords: | FP221, BING4, WDR46, WD repeat-containing protein 46, WD repeat-containing protein BING4 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
671.00€
*
Item number: CSB-PA026034GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: WDR46. Antigen Species: Human
| Keywords: | Anti-BING4, Anti-FP221, Anti-WDR46, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4, WDR46... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Item number: ABS-PP-691.100
Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium]
| Keywords: | WD repeat-containing protein 46, WD repeat-containing protein BING4, Recombinant Human WDR46 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 21 kD |
From 90.00€
*
Item number: ATA-APrEST96212.100
PrEST Antigen WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Antigen sequence: LSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Scaffold component...
| Keywords: | WDR46, BING4, FP221, WD repeat-containing protein 46, WD repeat-containing protein BING4 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-691-L.100
Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium]
| Keywords: | WD repeat-containing protein 46, WD repeat-containing protein BING4, Recombinant Human WDR46 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 21 kD |
From 115.00€
*