- Search results for GeneID 85443
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "GeneID 85443"!
Close filters
Filter by:
No results were found for the filter!
Item number: 600-401-AT2
Anti-DCLK3 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with DCLK3 from other sources has not been determined.
| Keywords: | Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,... |
| Application: | ELISA, IFM, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
848.00€
*
Item number: ATA-HPA040685.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 62% and to rat: 63%
| Keywords: | Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: CSB-PA002088.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
126.00€
*
Item number: CSB-PA990698.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
Item number: ABS-KC-3389.100
| Keywords: | Anti-Serine/threonine-protein kinase DCLK3, Anti-Doublecortin domain-containing protein 3C, Anti-Doublecortin-like and CAM... |
| Host: | Mouse |
| Species reactivity: | human, mouse |
From 232.00€
*
Item number: ATA-HPA053234.100
Polyclonal Antibody against Human DCLK3, Gene description: doublecortin like kinase 3, Alternative Gene Names: DCAMKL3, DCDC3C, KIAA1765, Validated applications: ICC, Uniprot ID: Q9C098, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 53% Rat gene...
| Keywords: | Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-9278-L.100
| Keywords: | Serine/threonine-protein kinase DCLK3, Doublecortin domain-containing protein 3C, Doublecortin-like and CAM kinase-like 3,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 115.00€
*
Item number: ATA-APrEST94096.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DCLK3, DCAMKL3, EC=2.7.11.1, Doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3, Doublecortin-like and CAM... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABD-8C11659.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-DCLK3 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Keywords: | Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,... |
| Application: | IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
628.00€
*
Item number: ELK-ES2151.100
catalytic activity:ATP + a protein = ADP + a phosphoprotein.,similarity:Belongs to the protein kinase superfamily.,similarity:Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.,similarity:Contains 1 protein kinase domain., Recommended dilutions: Western Blot: 1/500 -...
| Keywords: | Anti-DCLK3, Anti-DCAMKL3, EC=2.7.11.1, Anti-Doublecortin-like kinase 3, Anti-Serine/threonine-protein kinase DCLK3,... |
| Application: | WB, IHC, IF, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: ABS-PP-9278.100
| Keywords: | Serine/threonine-protein kinase DCLK3, Doublecortin domain-containing protein 3C, Doublecortin-like and CAM kinase-like 3,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 90.00€
*
Item number: ATA-APrEST95892.100
PrEST Antigen DCLK3, Gene description: doublecortin like kinase 3, Alternative Gene Names: DCAMKL3, DCDC3C, KIAA1765, Antigen sequence: PRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKL, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | DCLK3, DCAMKL3, EC=2.7.11.1, Doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3, Doublecortin-like and CAM... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*