9 products were found matching "GeneID 85395"!

No results were found for the filter!
Anti-FAM207A
Anti-FAM207A

Item number: ATA-HPA036354.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 54% and to rat: 52%
Keywords: Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A
Application: ICC, IHC, WB
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-SLX9
Anti-SLX9

Item number: ATA-HPA036559.100

Polyclonal Antibody against Human SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Validated applications: ICC, Uniprot ID: Q9NSI2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
Keywords: Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A
Application: ICC
Host: Rabbit
Species reactivity: human
463.00€ *
Review
NEW
Anti-SLX9
Anti-SLX9

Item number: ATA-HPA036559.25

Polyclonal Antibody against Human SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Validated applications: ICC, Uniprot ID: Q9NSI2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
Keywords: Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A
Application: ICC
Host: Rabbit
Species reactivity: human
323.00€ *
Review
SLX9 (human), recombinant protein
SLX9 (human), recombinant protein

Item number: ABS-PP-7089-L.100

Keywords: Ribosome biogenesis protein SLX9 homolog, Recombinant Human SLX9 Protein
Expressed in: E.coli
Origin: human
MW: 10.5 kD
From 115.00€ *
Review
Anti-CU070, CT (FAM207A, C21orf70, Protein FAM207A)
Anti-CU070, CT (FAM207A, C21orf70, Protein FAM207A)

Item number: 034360.200

Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
Keywords: Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A
Application: ELISA, IHC, WB
Host: Rabbit
Species reactivity: mouse
865.00€ *
Review
FAM207A PrEST Antigen
FAM207A PrEST Antigen

Item number: ATA-APrEST78832.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: PRED56, FAM207A, C21orf70, Protein FAM207A
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-F207A
Anti-F207A

Item number: ELK-ES16604.100

Protein function: May be involved in ribosome biogenesis. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus, nucleolus .
Keywords: Anti-PRED56, Anti-C21orf70, Anti-Ribosome biogenesis protein SLX9 homolog, F207A rabbit pAb
Application: WB
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
SLX9 (human), recombinant protein
SLX9 (human), recombinant protein

Item number: ABS-PP-7089.100

Keywords: Ribosome biogenesis protein SLX9 homolog, Recombinant Human SLX9 Protein
Expressed in: E.coli
Origin: human
MW: 10.5 kD
From 90.00€ *
Review
SLX9 PrEST Antigen
SLX9 PrEST Antigen

Item number: ATA-APrEST95873.100

PrEST Antigen SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Antigen sequence: KLAEQKHREERRRRATVVVGHLHPLRDALPELLGLEAGSRRQACSRESNKPWPSELSRMSAAQRQQLLEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat...
Keywords: PRED56, FAM207A, C21orf70, Protein FAM207A
Expressed in: E.coli
Origin: human
264.00€ *
Review