7 products were found matching "GeneID 84502"!
No results were found for the filter!
Anti-JPH4
Item number: 600-401-CC9
Anti-JPH4 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with JPH4 from other sources has not been determined. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the...
| Keywords: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Application: | ELISA, IHC, IFM, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
848.00€
*
Anti-JPH4
Item number: 600-401-CD0
Anti-JPH4 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with JPH4 from other sources has not been determined. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the...
| Keywords: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
848.00€
*
Anti-JPH4
Item number: ATA-HPA045022.100
Polyclonal Antibody against Human JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Validated applications: ICC, Uniprot ID: Q96JJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Junctophilins contribute to the formation of...
| Keywords: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
JPH4 (human), recombinant protein
Item number: ABS-PP-24831.100
Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release...
| Keywords: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10 kD |
From 90.00€
*
JPH4 (human), recombinant protein
Item number: ABS-PP-24831-L.100
Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release...
| Keywords: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10 kD |
From 115.00€
*
JPHL1, Human, Real Time PCR Primer Set
Item number: VHPS-4706
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Application: | RNA quantification |
45.00€
*
JPH4 PrEST Antigen
Item number: ATA-APrEST95836.100
PrEST Antigen JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Antigen sequence: PSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Junctophilins contribute...
| Keywords: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*