11 products were found matching "GeneID 83444"!

Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 95% and to rat: 96%

Polyclonal Antibody against Human INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Validated applications: ICC, Uniprot ID: Q9C086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...

Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

IN80B induces growth and cell cycle arrests at the G1 phase of the cell cycle. Applications: Suitable for use in Western Blot, Flow Cytometry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Flow Cytometry: 1:10-50, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...

Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.

Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]

Length: 1032 Sequence: atggaggccc ctgagccggg agaagccctg gagttgagcc tggcgggtgc ccatggccat ggagtgcaca agaaaaaaca caagaagcac aagaagaaac acaagaagaa acaccatcag gaagaagacg ccgggcccac gcagccgtcc cctgccaagc ctcagctcaa actcaaaatc aagcttgggg gacaagtcct ggggaccaag agtgttccta ccttcactgt gatcccagag gggcctcgct caccctctcc...

Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]

PrEST Antigen INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Antigen sequence: HKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....

0.5mg/ml if reconstituted with 0.2ml sterile DI water. INO80 complex subunit B is a protein that in humans is encoded by the INO80B gene. This gene encodes a subunit of an ATP-dependent chromatin remodeling complex, INO80, which plays a role in DNA and nucleosome-activated ATPase activity and ATP-dependent...