- Search results for GeneID 8312
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
20 products were found matching "GeneID 8312"!
Close filters
Filter by:
No results were found for the filter!
Item number: ABS-KC-1213.100
Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (PubMed:12192039, PubMed:27098453). Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt...
Keywords: | Anti-Axin-1, Anti-Axis inhibition protein 1, Anti-hAxin, AXIN1 Antibody |
Host: | Mouse |
Species reactivity: | human |
From 232.00€
*
Item number: ATA-HPA073924.100
Polyclonal Antibody against Human AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Validated applications: ICC, WB, Uniprot ID: O15169, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the beta-catenin destruction complex...
Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1 |
Application: | WB, ICC |
Host: | Rabbit |
Species reactivity: | human |
450.00€
*
Item number: CSB-PA828936.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: AXIN1. Antigen Species: Human
Keywords: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, axin 1, AXIN1 Antibody |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: CSB-PA914369.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: AXIN1. Antigen Species: Human
Keywords: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, axin 1, AXIN1 Antibody |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: ARG63283.100
Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt signaling pathway and ventralize...
Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1 |
Application: | ELISA, IHC (paraffin) |
Host: | Goat |
Species reactivity: | human |
822.00€
*
Item number: G-HUFI02140.96
ELISA Type: Sandwich. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma. Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (PubMed:12192039,...
Keywords: | AXIN, AXIN1, hAxin, Axin-1, Axis inhibition protein 1 |
Application: | Sandwich ELISA |
Species reactivity: | human |
641.00€
*
Item number: NSJ-R34056-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Axis inhibition protein 1 Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating...
Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, AXIN1 Antibody |
Application: | IHC, ELISA (peptide) |
Host: | Goat |
Species reactivity: | human |
790.00€
*
Item number: NSJ-F45423-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. AXIN1 is a component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt...
Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, AXIN1 Antibody |
Application: | WB, ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 350.00€
*
Item number: NSJ-F41872-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Axin-1 is a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2,...
Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, Axin-1 Antibody |
Application: | WB, IHC, ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 350.00€
*

Item number: ABS-PP-690.100
Keywords: | Axin-1, Axis inhibition protein 1, hAxin, Recombinant Human AXIN1 Protein |
MW: | 15.5 kD |
From 90.00€
*

Item number: ATA-APrEST95824.100
PrEST Antigen AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Antigen sequence: AWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the beta-catenin destruction...
Keywords: | AXIN, hAxin, AXIN1, Axin-1, Axis inhibition protein 1 |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: CSB-PA517675LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: AXIN1. Antigen Species: Human
Keywords: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, AI316800 antibody, AXIN antibody, Axin 1... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*