10 products were found matching "GeneID 81789"!

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 36% and to rat: 36%

0.5mg/ml if reconstituted with 0.2ml sterile DI water. The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases....

Polyclonal Antibody against Human TIGD6, Gene description: tigger transposable element derived 6, Alternative Gene Names: DKFZp761E2110, Validated applications: ICC, Uniprot ID: Q17RP2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat gene...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Buffer: PBS and 1M Urea, pH 7.4.

Recommended dilutions: WB 1:1000-2000. Cellular localization: Nucleus .

Length: 1566 Sequence: atggcaaaca aggggaacaa gaagcgtcgg cagttctctc tggaggagaa aatgaaagtt gtgggagctg tagactcagg caagaggaaa ggtgatgtgg caaaagaatt tggtatcact ccctctactt tatctacatt cttaaaggat cgcaccaaat ttgaagaaaa ggtgcgggag gcatccgtgg gaccccagcg gaaaaggatg aggagcgctc tttatgatga cattgataag gctgtttttg cttggtttca...

PrEST Antigen TIGD6, Gene description: tigger transposable element derived 6, Alternative Gene Names: DKFZp761E2110, Antigen sequence: MANKGNKKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGPQRKRMRSALYDDIDKAVFAWFQEIHAK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...